DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3587 and Pstk

DIOPT Version :9

Sequence 1:NP_569965.1 Gene:CG3587 / 31160 FlyBaseID:FBgn0023521 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001034623.1 Gene:Pstk / 214580 MGIID:2685945 Length:359 Species:Mus musculus


Alignment Length:332 Identity:71/332 - (21%)
Similarity:125/332 - (37%) Gaps:99/332 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVVITGLPASGKSTRAR----QLRDHFVERGRKVHLISENEAVPKAGFGKNSHTGDSQKEKVVRS 63
            |.|:.||||:||||.||    :||.   |||..|.::|.::.:|.|....:.......:.|:.|.
Mouse    20 LCVLCGLPAAGKSTFARALALRLRR---ERGWAVGVLSYDDVLPLALPDCDGTQPRPSQWKMFRQ 81

  Fly    64 DL----------------------KSEASRH-----LNQEDLVI--------------------- 80
            :|                      ::||...     |..:||:|                     
Mouse    82 ELLKHLECFLVAVISGAQMSAPPNRTEAVWEDFITCLKSQDLMIFPTALEAQPCHLLAKPAVSRP 146

  Fly    81 ----LDAGNYIKGYRYELYCMSKVSRTTQCTVFTCIPQEEAWTFNSQRTAPDELPGDSERVQPVD 141
                ||...|.:..|||:|.:::......|.:|...|.|.....|.:|:.|  ||.         
Mouse   147 LFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLKRNGERSQP--LPD--------- 200

  Fly   142 NSDVPYTRETFDALCQRYEEPQ-SNNRWDSPLVVVLP-----KDTLDMEAIYKALYESQPLP--- 197
                    ||...:.::.|:|. ..|.|:...:::..     :.:|::..:.....|: |:.   
Mouse   201 --------ETIQLMGRKIEKPNPEKNAWEHNSLIIQSSACSLEASLEVTGLLLTALEN-PIKCVE 256

  Fly   198 --PNQSTYNAPLGTTNYLFELDKIVQAIIKEILGAVKIKAFGQLRIPGSRNPVKVATSMNALQ-- 258
              ..|...:..:.:||.|.:.|:.::..:.:.:...|.:     :|| ..|...:|..:|.|:  
Mouse   257 DNTEQKETDRIICSTNILHKADETLRRTVSQTMREAKDE-----QIP-LNNLKHLAEELNKLKAD 315

  Fly   259 -LNRLRQ 264
             |..|||
Mouse   316 VLEDLRQ 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3587NP_569965.1 KTI12 3..293 CDD:285611 71/332 (21%)
NK 3..263 CDD:302627 68/329 (21%)
PstkNP_001034623.1 selen_PSTK_euk 20..358 CDD:188340 71/332 (21%)
KTI12 20..343 CDD:285611 71/332 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.