DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3587 and pstk-1

DIOPT Version :9

Sequence 1:NP_569965.1 Gene:CG3587 / 31160 FlyBaseID:FBgn0023521 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_499627.1 Gene:pstk-1 / 190070 WormBaseID:WBGene00013041 Length:259 Species:Caenorhabditis elegans


Alignment Length:297 Identity:53/297 - (17%)
Similarity:102/297 - (34%) Gaps:99/297 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISENEAVPKAGF-----------GKNSHTGD 54
            |.|:::.|:|||||||..|:::            .:..|.:....|           .||:....
 Worm     1 MALLLVMGIPASGKSTFRRKIQ------------TAHRELLESTSFDDFRMMRTRSSDKNARQTR 53

  Fly    55 SQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSKVSRTTQCTVFTCIPQEEAWT 119
            ...|..|.|.:....|:....||:.      |:|..|:....::|........:|..:...||..
 Worm    54 KSFECHVESCISESTSKIYVIEDIF------YLKSMRHPFQKIAKRHGLQFGIIFLKVGIVEALR 112

  Fly   120 FNSQRTAPDELPGDSERVQPVDNSDVPYTRETFDALCQRYEEPQSNNRWDSPLVVVLPKDTLDME 184
            .||.||..::                 ...||...:.::.|:|  :...::.:|:...:..:|:|
 Worm   113 RNSHRTGIEK-----------------QKNETIRKIFEKMEDP--DEILENSIVLETDEVEIDVE 158

  Fly   185 AIYKAL-------------------YESQPLPPNQSTYNAPLGTTNYLFELDKIVQAIIKEILGA 230
            .:...|                   :..:|.||::            |..||.:.:.::.|::..
 Worm   159 VVMNKLKFDFTAKKPIVPEVSLKKSHIQKPPPPSK------------LESLDVLTRRLVSELMQN 211

  Fly   231 VKIKAFGQLRIPGSRNPVKVATSMNALQLNRLRQKFI 267
            .|                    :||..:|:..|:|.:
 Worm   212 DK--------------------TMNGRKLSDARKKLL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3587NP_569965.1 KTI12 3..293 CDD:285611 52/295 (18%)
NK 3..263 CDD:302627 50/289 (17%)
pstk-1NP_499627.1 NK 3..228 CDD:302627 52/293 (18%)
AAA_33 3..135 CDD:290396 33/166 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.