DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11596 and carnmt1

DIOPT Version :9

Sequence 1:NP_726779.1 Gene:CG11596 / 31158 FlyBaseID:FBgn0023522 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001119994.1 Gene:carnmt1 / 100144950 XenbaseID:XB-GENE-5961224 Length:373 Species:Xenopus tropicalis


Alignment Length:379 Identity:161/379 - (42%)
Similarity:229/379 - (60%) Gaps:37/379 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EEE--EEKHIQKVQNAFLYYGPYACQRLKRSMDYLNSLSGEDQIMLAKYRGHLECVRTCIDRNQA 89
            |||  |:.|..|:.:||:.||....:::.|:.....|||...|.:|..:..||:.:|.||:.||.
 Frog    20 EEEALEKDHFWKIISAFIGYGSSIHEQVNRTERQFKSLSKNQQKLLPHFVPHLDKIRECINHNQK 84

  Fly    90 VIREILRGRVLYPTDEATG--DPSEFDE------PPPNVRHGDMDQIDIPFDEADVEPLKILKAQ 146
            :::.|:        |:.|.  :..|:.|      .||:.  .|||                 |.:
 Frog    85 ILQMIV--------DDCTHMFENKEYGEKGYRKPTPPST--FDMD-----------------KLK 122

  Fly   147 STLKLIARDWSTEGALEREQSYKPIIDSIVAYFKHSDFELKDIKILVPGAGLGRLTYELACLGYS 211
            ||:|...||||.:|..||:..|:||||.|:.:|...:.::.:|.|||||||||||.:|:|..|||
 Frog   123 STIKQFVRDWSEDGKSERDACYQPIIDEILKHFPKDESDVSNINILVPGAGLGRLAWEIAKHGYS 187

  Fly   212 CEGNEFSYFMLIASNFVLNLCDNENKYVLYPWVHQYVNNLRREDQVAPVRFPDVCPLKNPPKGHF 276
            |:|||:|:|||.:||||||.|...|.:.:|||:||:.||.|..||:.|..||||.|...||..:|
 Frog   188 CQGNEWSFFMLFSSNFVLNRCSEINTFKIYPWIHQFSNNRRSSDQIRPAYFPDVNPHDLPPNANF 252

  Fly   277 EIAAGDFLEVYKTPNAYNCVATCFFIDCANNVIDFIRTIYKILVPGGIWVNLGPLLYHFSDVSGQ 341
            .:.||||.|:|....:::|:|||||||.|:||:|:|.||:|||.|||||:|||||||||.:::.:
 Frog   253 SMTAGDFEEIYTDKGSWDCIATCFFIDTAHNVLDYIDTIWKILKPGGIWINLGPLLYHFENMANE 317

  Fly   342 NSIEPAFEDLCIIMESVGFVIEKSRTGIRTKYAQNPSSMKQSEYQSLFWVCRKP 395
            .|||.::||:..:....||.||..:..:.|.|..|..||.:..|..:|:|.|||
 Frog   318 LSIELSYEDIKNVALQYGFHIEFEKESVSTTYTVNSLSMMKYFYDCVFFVARKP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11596NP_726779.1 N2227 114..396 CDD:285218 134/288 (47%)
carnmt1NP_001119994.1 N2227 108..371 CDD:369608 131/281 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6806
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55992
OrthoDB 1 1.010 - - D1437030at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12303
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1981
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.