DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11596 and nmrk1

DIOPT Version :10

Sequence 1:NP_726779.1 Gene:CG11596 / 31158 FlyBaseID:FBgn0023522 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_012822820.1 Gene:nmrk1 / 100125192 XenbaseID:XB-GENE-993956 Length:221 Species:Xenopus tropicalis


Alignment Length:96 Identity:18/96 - (18%)
Similarity:44/96 - (45%) Gaps:14/96 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVLGKVLKQLTPLQIFELSQSSMRMPTLIKSIMAFD---RILIDLTKERKSIIFYNNWEREPA-- 68
            |.:|..:|::|.::..:::.:|::| :.:|..:..:   .:.|:.....:.:  .|.:.:|.|  
 Frog   230 AHVGGRIKEITAVRTCQVAMNSLKM-SEVKDCLELEIAGSVNIEAADIGRGL--SNKFCKEKANN 291

  Fly    69 ----IFFHVDYKPDVYDTKLKIGKLRITMTD 95
                ..||..:....|:  :|.||....:.|
 Frog   292 INQGSDFHTSFNERTYE--IKGGKATFNLFD 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11596NP_726779.1 CARME 114..396 CDD:400340
nmrk1XP_012822820.1 NRK1 6..171 CDD:238982
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.