DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and INP54

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_014576.1 Gene:INP54 / 854089 SGDID:S000005426 Length:384 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:78/295 - (26%)
Similarity:132/295 - (44%) Gaps:64/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 DIYAIGLQELDTPTKAMLNSTQVQAIEKQWIDKM-----------MDSVHPDVEYEILMSHRLVA 271
            |:|.:|.||:     ..:......|:.:..||::           :.:...|.:|..|..:.|.|
Yeast    46 DLYVLGFQEV-----VPIWQGSFPAVNRDLIDRITTTAVNCLNEKVSATQGDEQYSCLGVNSLGA 105

  Fly   272 TMLTVIVRK---QLRQHIIRCRPKSVARGIFNTLGNKGGVAISLQL------NEGNICFVNSHLA 327
            ..:.|:...   :::..|::...|.   |.|.| ..|||..||.|:      |.....::.:||.
Yeast   106 ITIIVLYNNNALKVKDDILKRNGKC---GWFGT-HLKGGTLISFQMTRNGEENWERFSYICAHLN 166

  Fly   328 AHMGYVEERNQ---DYNAIVEGIRFDDGRTISDHDHIFWVGDLNYRI---QEPPGQQRPGPLSDA 386
            |:.| |..|||   ||..|:..:...:   ::..||.|::||||:|:   .:|...     .|..
Yeast   167 ANEG-VNNRNQRIDDYKRIMSEVCDSE---VAKSDHFFFLGDLNFRVTSTYDPTTN-----YSST 222

  Fly   387 QTYELLLQYDQLRQEMRRGK----CFEGYTEGEIKFRPTYK---YDPGTDNYDSSEKQRAPAYCD 444
            .|...||:..:....:|:|:    | :|:.|.:|.|.||||   ::..|.|     .:|.|::||
Yeast   223 TTLRRLLENHEELNLLRKGEDEPLC-KGFQELKITFPPTYKFKLFEKETYN-----TKRIPSWCD 281

  Fly   445 RVLWKGTRIEQLA----YNSIME---IRQSDHKPV 472
            |:|:|...:...|    |:|:..   :..|||:||
Yeast   282 RILYKSYAVPTFAQEGTYHSVPRSNALLFSDHQPV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 78/295 (26%)
RhoGAP_OCRL1 614..823 CDD:239845
INP54NP_014576.1 COG5411 1..371 CDD:227698 78/295 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341656
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11200
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.