DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and FRA3

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_176736.2 Gene:FRA3 / 842869 AraportID:AT1G65580 Length:1101 Species:Arabidopsis thaliana


Alignment Length:609 Identity:151/609 - (24%)
Similarity:246/609 - (40%) Gaps:147/609 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VKQELKKRESEYIVYKDIIIYCATWNV-NNKTCSDSNNPLRAWLACSEKPPDIYAIGLQELDTPT 231
            ::.||..:|..|...:::.|...|||| ..:..:||   |.:||.|:....:|..:||||::...
plant   521 LRAELAGKEFLYSRIENLKILAGTWNVGEGRASTDS---LVSWLGCAATGVEIVVVGLQEVEMGA 582

  Fly   232 KAMLNSTQVQAIEKQ-------WIDKMMDSVHPDVEYEILMSHRLVATMLTVIVRKQLRQHIIRC 289
            ..:..|...:.:..:       |:|.:..::.....:..:.|.:|...::.|.||..|:.|:...
plant   583 GVLAMSAAKETVGLEGSPLGQWWLDMIGKTLDEGSSFVRVGSRQLAGLLICVWVRHDLKPHVGDV 647

  Fly   290 RPKSVARGIFNTLGNKGGVAISLQLNEGNICFVNSHLAAHMGYVEERNQDY-------------- 340
            ...:|..|....:||||.|.:.|::.:..:||||.|.|||:..|..||.|:              
plant   648 DAAAVPCGFGRAIGNKGAVGVRLRMYDRVLCFVNCHFAAHLEAVNRRNADFDHVYRTMTFSRQSS 712

  Fly   341 --NAIVEGIRFDDGRT------------------ISDHDHIFWVGDLNYRIQEPPGQQRPGPLSD 385
              ||.|.|..|  |.|                  :|:.|.:.::||.|||:.:....:....:|.
plant   713 SLNAGVAGASF--GVTMPRGGNALGVNTIEARPELSEADMVIFLGDFNYRLDDITYDETRDFISQ 775

  Fly   386 AQTYELLLQYDQLRQEMRRGKCFEGYTEGEIKFRPTYKYD---PGTDNYDSSEKQRAPAYCDRVL 447
             :.::.|.:.|||..||..|..|:|..|..|:|.||||::   .|...|||.||:|.||:|||:|
plant   776 -RCFDWLREKDQLHTEMEAGNVFQGMREAIIRFPPTYKFERHQAGLAGYDSGEKKRIPAWCDRIL 839

  Fly   448 WKGTR----------------IEQLAYNSIMEIRQSDHKPVYAVFQVKVKTRDEVKYKRVQEEVL 496
            ::..:                |.|  |::.||:..||||||..||.||:...||           
plant   840 YRDNKKHLGAECSLDCPVVSSISQ--YDACMEVTDSDHKPVRCVFSVKIARVDE----------- 891

  Fly   497 KAVDKRENDNQPQIN------------VEKTVIDFGTVRFNEPSTRDFNVYNNCPLPVDFSFKEK 549
             :|.::|..|....|            |.:|::....:......:....:.|.....:.| ||  
plant   892 -SVRRQEYGNIINSNKKIKVLLGELSKVPETIVSTNNIILQNQDSTILRITNKSEKNIAF-FK-- 952

  Fly   550 DIHAICE-----------------------PWLHVDPRQDSLLIDSAR--SIRLKMNANVRT-IA 588
               .|||                       .||.|.|...::..:...  |:.|:....|.. :.
plant   953 ---IICEGQSKIEEDGQAHDHRARGSFGFPQWLEVSPGTGTIKPNQIAEVSVHLEDFPTVEEFVD 1014

  Fly   589 GLLRKIRASDNFD--ILILHVENGRDIFITVT------------GDYQPSCFGLSMET------M 633
            |:.:.....|..|  ::::.|.:||  |.|.|            |....:.|....:|      :
plant  1015 GVAQNSWCEDTRDKEVILVLVVHGR--FSTETRKHRIRVRHCPRGGPAKNHFNDGTKTSGQINAL 1077

  Fly   634 CRTDRPLSEYSQDQIKQLMNDESP 657
            .|:|......:.|.::||.|..||
plant  1078 HRSDYHQLSNTLDVVEQLKNLHSP 1101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 103/353 (29%)
RhoGAP_OCRL1 614..823 CDD:239845 14/62 (23%)
FRA3NP_176736.2 WD40 182..510 CDD:421866
WD40 repeat 186..221 CDD:293791
WD40 repeat 230..264 CDD:293791
WD40 repeat 413..442 CDD:293791
WD40 repeat 449..481 CDD:293791
INPP5c 538..884 CDD:197308 103/353 (29%)
Motile_Sperm 919..1043 CDD:421531 22/131 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101357
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.670

Return to query results.
Submit another query.