DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and FRA3

DIOPT Version :10

Sequence 1:NP_569962.2 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_176736.2 Gene:FRA3 / 842869 AraportID:AT1G65580 Length:1101 Species:Arabidopsis thaliana


Alignment Length:154 Identity:28/154 - (18%)
Similarity:54/154 - (35%) Gaps:45/154 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 FVNKVYGFYEECQKR--------YQSVRMFTAFQD---VFNWLP----LCGLIAN------KILC 169
            ||...|.:.||..::        :.|...::.|||   ...|..    :.||::|      :::.
plant    86 FVKAGYEYDEETFEKIFRRIYSTFGSAAPYSVFQDSQPFLRWARRKGLIVGLVSNAEYRYQEVIL 150

  Fly   170 MHGGLSPSHDGKERLVADLLWADPI-SGLSGFMENN--------RGAGCGFGRDAVLKVCSDFKL 225
            ...|||.:.           |...: ||:.|..:.:        ..||.....:.||.:....:.
plant   151 PSFGLSKAE-----------WDFGVFSGIEGIEKPDPRIFTLALERAGNNIAPEEVLHIGDSMRK 204

  Fly   226 DLI----CRAHQVVQDGYEFFAGR 245
            |.:    ...|.::.|.::..|.:
plant   205 DYVPAKSIGMHALLVDRFKTEAAK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_569962.2 INPP5B_PH 23..160 CDD:465268 10/48 (21%)
INPP5c_INPP5B 185..478 CDD:197327 12/74 (16%)
RhoGAP_OCRL1 614..823 CDD:239845
FRA3NP_176736.2 WD40 117..513 CDD:441893 22/123 (18%)
WD40 repeat 186..221 CDD:293791 6/34 (18%)
WD40 repeat 230..264 CDD:293791
WD40 repeat 413..442 CDD:293791
WD40 repeat 449..481 CDD:293791
INPP5c 538..884 CDD:197308
Motile_Sperm 919..1043 CDD:459882
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.