DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and CVP2

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_001322092.1 Gene:CVP2 / 837048 AraportID:AT1G05470 Length:617 Species:Arabidopsis thaliana


Alignment Length:413 Identity:124/413 - (30%)
Similarity:189/413 - (45%) Gaps:88/413 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SHHYEEFVAKVISFKSTMAQHDPETVLNFRWLNDYRQIGEVKQELKKRESEYIVYKDIIIYCATW 192
            ||...:|..   ||:.:.:.|.|         :||   .....:..:|.|:|             
plant   236 SHRPSDFDP---SFRGSSSSHRP---------SDY---SRRPSDYSRRPSDY------------- 272

  Fly   193 NVNNKTCSD-SNNPLRAWLACSEKPPDIYA--------------------IGLQELDTPTKAMLN 236
               ::..|| |..|..:..:...:|.|.|:                    :|    |:|: .:|.
plant   273 ---SRRPSDYSRRPSDSRPSDYSRPSDYYSRPSDYSRPSDFSRSSDDDNGLG----DSPS-TVLY 329

  Fly   237 STQVQAIEKQWIDKMMDSVHPDVEYEILMSHRLVATMLTVIVRKQLRQHIIRCRPKSVARGIFNT 301
            |....|.|..:......|     :|.::.|.::|...||:.|:.:||:|:...:...|.||:...
plant   330 SPGSAANENGYRIPWNSS-----QYCLVASKQMVGVFLTIWVKSELREHVKNMKVSCVGRGLMGY 389

  Fly   302 LGNKGGVAISLQLNEGNICFVNSHLAAHMGYVEE--RNQDYNAIVEGIRF---------DDGRTI 355
            |||||.::||:.|::.:.|||.:||.:.....:|  ||.|...|::..||         .....|
plant   390 LGNKGSISISMLLHQTSFCFVCTHLTSGQKEGDELKRNSDVMEILKKTRFPRVKSSEEEKSPENI 454

  Fly   356 SDHDHIFWVGDLNYRIQEPPGQQRPGPLSDAQTYELLLQYDQLRQEMRRGKCFEGYTEGEIKFRP 420
            ..||.:.|:|||||||  ....:....|.:.|.:..||:.||||.|.:||..|:|:.||:|.|.|
plant   455 LQHDRVIWLGDLNYRI--ALSYRSAKALVEMQNWRALLENDQLRIEQKRGHVFKGWNEGKIYFPP 517

  Fly   421 TYKYDPGTDNYDS-----SEKQRAPAYCDRVLWKGTRIEQLAYNSIMEIRQSDHKPVYAVFQVKV 480
            ||||...:|.|..     .||:|.||:|||:||.|..:.||:|.. .|.|.|||:|||.:|..:|
plant   518 TYKYSRNSDRYSGDDLHPKEKRRTPAWCDRILWFGEGLHQLSYVR-GESRFSDHRPVYGIFCAEV 581

  Fly   481 KT-RDEVK------YKRVQEEVL 496
            :: .:.:|      ..|||.|.|
plant   582 ESAHNRIKRTTSYSASRVQAEEL 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622 8/34 (24%)
INPP5c_INPP5B 185..478 CDD:197327 105/329 (32%)
RhoGAP_OCRL1 614..823 CDD:239845
CVP2NP_001322092.1 EEP 1..605 CDD:412407 124/413 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1399831at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2994
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X494
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.