DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and IP5PII

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_567547.1 Gene:IP5PII / 827526 AraportID:AT4G18010 Length:646 Species:Arabidopsis thaliana


Alignment Length:484 Identity:141/484 - (29%)
Similarity:227/484 - (46%) Gaps:72/484 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EAYQIKGPEYSNRLLALVSSQSGGTFAIIAFSYLRTPLSSANELIINKV---FAIDHNFQLRQDS 100
            |:...:.|..:|.  ||..|.|..:..|:|        ..||.:|.:.:   ...||:..|..:.
plant   185 ESVYDQSPSCNNN--ALHRSHSAPSSPILA--------QEANSIISHVMVENLVADHSLDLATNE 239

  Fly   101 KSSITTQQFDLSTAEDGPIKYYYYATESHHY----EEFVAKVISFKSTMAQHDPETVLN-FRWLN 160
            .....|....|....:..:.:...|.:|:..    |..:.:|.|..:|:....||.... .|:.:
plant   240 FIDAATALPSLEPQRNPNMDWPELALDSNPQIVGSEGKLRRVFSSNATLGFKLPENPSGASRFAS 304

  Fly   161 DYRQIGEVKQELKKRESEYIVYKDIIIYCATWN-----VNNKTCSDSNNPLRAWLACSEKPPDIY 220
            :.||:        ||...:....      .:||     ::|::.|.|.         :|:...|.
plant   305 EARQL--------KRSRSFETLN------LSWNDIKEEIDNRSSSSSE---------AEEAAKIM 346

  Fly   221 AIGLQELDTPTKAMLNSTQVQ---AIEKQWID---KMMDSVHPDVEYEILMSHRLVATMLTVIVR 279
            .....:.|:.::...:..:::   .:.:..::   |:.||    .:|..::|.::|...::|.:|
plant   347 HDDSSDGDSSSQDEEDGDKIRNSYGLPEDLVEECRKVKDS----QKYVRIVSKQMVGIYVSVWIR 407

  Fly   280 KQLRQHIIRCRPKSVARGIFNTLGNKGGVAISLQLNEGNICFVNSHL-AAHM-GYVEERNQDYNA 342
            ::||:|:...:...|..|:...:||||.|:||:.|.:..:|||.||| :.|. |..:.||.|...
plant   408 RRLRRHVNNLKVSPVGVGLMGYMGNKGSVSISMTLYQSRMCFVCSHLTSGHKDGAEQRRNADVYE 472

  Fly   343 IVEGIRF------DDGRTISDHDHIFWVGDLNYRIQEPPGQQRPGPLSDAQTYELLLQYDQLRQE 401
            |:...||      |..|||..||.:||.||||||:....|:.|  .|...:.::.|...|||.:|
plant   473 IIRRTRFASVLDTDQPRTIPCHDQVFWFGDLNYRLNMSDGEVR--KLVSQKRWDELKNSDQLIRE 535

  Fly   402 MRRGKCFEGYTEGEIKFRPTYKYDPGTDNYDSS-----EKQRAPAYCDRVLWKGTRIEQLAYNSI 461
            :|||..|:|:.||.|||.|||||:..:|.|...     ||:||||:|||:||.|..|.|..|.. 
plant   536 LRRGHVFDGWREGPIKFPPTYKYEFDSDRYAGENLREPEKKRAPAWCDRILWLGKGIRQECYKR- 599

  Fly   462 MEIRQSDHKPVYAVFQVKVKTRDEVKYKR 490
            .|||.|||:||.::|.|.|:..|..|.:|
plant   600 SEIRMSDHRPVTSIFNVGVEVFDHRKLQR 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622 26/131 (20%)
INPP5c_INPP5B 185..478 CDD:197327 106/316 (34%)
RhoGAP_OCRL1 614..823 CDD:239845
IP5PIINP_567547.1 PLN03191 1..646 CDD:215624 141/484 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 193 1.000 Domainoid score I922
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1399831at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2994
orthoMCL 1 0.900 - - OOG6_101357
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X494
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.