DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and AT2G01900

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_001323555.1 Gene:AT2G01900 / 814721 AraportID:AT2G01900 Length:425 Species:Arabidopsis thaliana


Alignment Length:418 Identity:128/418 - (30%)
Similarity:205/418 - (49%) Gaps:62/418 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EFVAKVISFKSTMAQHDPET---VLNFRWLNDYRQIGEVKQELKKRESEYIVYKDIIIYCATWNV 194
            :.:.|.:...:.:|...|.|   ::....|.|.|....:..:.|   :..:.||   ::.:||||
plant    17 KILRKSLGSNNFVADFPPNTDQKLIEASGLADERSKSILHNQHK---TTLLNYK---VFVSTWNV 75

  Fly   195 NNKTCSDSNNPLRAWLACSEKPPDIYAIGLQELDTPTKA--MLNSTQVQAIEKQWIDKMMDSV-- 255
            .. ...|....:...|...:.|.|||.:|.||: .|.:|  :|.|.. ..:..:|...:.|::  
plant    76 GG-IVPDDGLDMEDLLETHKTPCDIYVLGFQEV-VPLRASNVLGSDN-NKVSTKWNSLIRDALNK 137

  Fly   256 ----HPD-------------VEYEILMSHRLVATMLTVIVRKQLRQHIIRCRPKSVARGIFNTLG 303
                |.|             .::..::|.::|..::||.||..|..:|.......|..||...||
plant   138 RARPHRDEDLSESKGINGISQDFRCIISKQMVGILITVWVRGDLWPYIRYPSVSCVGCGIMGCLG 202

  Fly   304 NKGGVAISLQLNEGNICFVNSHLAAHMGYVEE--RNQDYNAIV------EGIRFDDGRTISDHDH 360
            |||.|::..||:|...|||.||||:.....:|  ||.|.|.|:      .|...|..:.|.|||.
plant   203 NKGSVSVRFQLHETTFCFVCSHLASGGRDRDERQRNSDVNEILARSSFPRGSSLDLPKKILDHDR 267

  Fly   361 IFWVGDLNYRIQEPPGQQRPGPLSDAQTYELLLQYDQLRQEMRRGKCFEGYTEGEIKFRPTYKYD 425
            :.::|||||||..|  :::...|.:::.:.:||:.||||.|:..|:.|.|:.||.:||.|||||.
plant   268 VIFLGDLNYRISLP--EEKTRLLVESKKWNILLENDQLRMEIMNGQIFRGWQEGIVKFAPTYKYV 330

  Fly   426 PGTD------NYDSSEKQRAPAYCDRVLWKGTRIEQLAYNSIMEIRQSDHKPVYAVFQVKVK-TR 483
            |.:|      .|...||:||||:|||::|.|..::|..|.. .|.:.|||:||.|:|..::. ||
plant   331 PNSDLYYGCITYKKDEKKRAPAWCDRIIWYGNGLKQHEYTR-GETKISDHRPVKAIFTTEITVTR 394

  Fly   484 DEVKYKRVQ--------EEVLKAVDKRE 503
               :.|:::        ||.:..:|.::
plant   395 ---RGKKIRNFFFSDRFEERIGDIDSKD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622 6/32 (19%)
INPP5c_INPP5B 185..478 CDD:197327 112/327 (34%)
RhoGAP_OCRL1 614..823 CDD:239845
AT2G01900NP_001323555.1 EEP 3..392 CDD:412407 122/386 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 193 1.000 Domainoid score I922
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1399831at2759
OrthoFinder 1 1.000 - - FOG0002633
OrthoInspector 1 1.000 - - otm2994
orthoMCL 1 0.900 - - OOG6_101357
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X494
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.