DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and sh2d1aa

DIOPT Version :10

Sequence 1:NP_569962.2 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_001108163.1 Gene:sh2d1aa / 797046 ZFINID:ZDB-GENE-060526-212 Length:106 Species:Danio rerio


Alignment Length:48 Identity:11/48 - (22%)
Similarity:21/48 - (43%) Gaps:7/48 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 IGEVKQELKKRESEYIVYKDIIIYCATWNVNNKTCSDSNNPLRAWLAC 212
            :.|....:.|:::|     ||:  |:|....:....||.:...|:..|
Zfish     4 LAEYHGSISKKQAE-----DIL--CSTGRDGSYLIRDSLSSAGAYCVC 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_569962.2 INPP5B_PH 23..160 CDD:465268
INPP5c_INPP5B 185..478 CDD:197327 7/28 (25%)
RhoGAP_OCRL1 614..823 CDD:239845
sh2d1aaNP_001108163.1 SH2 2..103 CDD:472789 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.