DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and LOC569568

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:XP_009303404.2 Gene:LOC569568 / 569568 -ID:- Length:790 Species:Danio rerio


Alignment Length:353 Identity:101/353 - (28%)
Similarity:154/353 - (43%) Gaps:95/353 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 DIIIYCATWNVNNKTCSDSNNPLRAWLACSEKPP----------------DIYAIGLQELDTPTK 232
            |..::..||||.                 |..||                |::.:||||::    
Zfish   213 DFRVHIVTWNVG-----------------SGMPPDDITSLFGPGIENGSTDMFVVGLQEVN---- 256

  Fly   233 AMLNSTQVQAI-EKQWIDKMMDSVHPDVEYEILMSHRLVATMLTVIVRKQLRQHIIRCRPKSVAR 296
            :|:|.....|: ..||.:..||:: ....|.::.|.|:....|.|..:......:...:.:|...
Zfish   257 SMINKRLKDALFTDQWSELCMDTL-SRFGYVLVASQRMQGVFLLVFSKFCHLPFLRGVQTQSTRT 320

  Fly   297 GIFNTLGNKGGVAISLQLNEGNICFVNSHLAAHMGYVEERNQDYNAIVEGIRFDDGRTIS--DHD 359
            |:....||||||:..:.:....:||:|.||.|||..:|:|.:|:.:|::..:|:....:.  |||
Zfish   321 GLGGYWGNKGGVSARMMVFGHPVCFLNCHLPAHMRNLEQRMEDFESILQQQQFEGSNAVGVLDHD 385

  Fly   360 HIFWVGDLNYRIQEPPGQQRPGPLSDAQTYE--------------LLLQYDQLRQEMRRGKCFEG 410
            .:||.||||:||               :.|:              ||.:.|||....:.....||
Zfish   386 VVFWFGDLNFRI---------------EGYDIHVVKSAIENDKLPLLWEKDQLNMAKKSESVLEG 435

  Fly   411 YTEGEIKFRPTYKYDPGTDNYDSSEKQRAPAYCDRVLWK-------------------------G 450
            :.||.:||.||||:|.||..||:|.|:|.||:.||:||:                         .
Zfish   436 FIEGPLKFPPTYKFDVGTHTYDTSAKKRKPAWTDRILWRLRRTGSPVPSHNSALQRGLTSWLGGA 500

  Fly   451 TRIEQLAYNSIMEIRQSDHKPVYAVFQV 478
            ||:.|..|.|.|....||||||.|:|.:
Zfish   501 TRVSQHFYCSHMGFTISDHKPVSALFSL 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 100/350 (29%)
RhoGAP_OCRL1 614..823 CDD:239845
LOC569568XP_009303404.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.