DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and INPP5E

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_063945.2 Gene:INPP5E / 56623 HGNCID:21474 Length:644 Species:Homo sapiens


Alignment Length:384 Identity:101/384 - (26%)
Similarity:167/384 - (43%) Gaps:101/384 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 SEYIVYKDIIIYCATWNVNNKTCSDSNNPLRAWLACSEKPP---------------DIYAIGLQE 226
            :.|...:::.::.||||:..:               .|.||               |:|.||:||
Human   291 ARYFPDRNVALFVATWNMQGQ---------------KELPPSLDEFLLPAEADYAQDLYVIGVQE 340

  Fly   227 LDTPTKAMLNSTQVQAIEKQWIDKMMDSVHPDVEYEILMSHRLVATMLTVIVRKQLRQHIIRCRP 291
            ..:.             .::|..::.:::.|  .|.:|.|.......:::.:|:.|.........
Human   341 GCSD-------------RREWETRLQETLGP--HYVLLSSAAHGVLYMSLFIRRDLIWFCSEVEC 390

  Fly   292 KSVARGIFNTLGNKGGVAISLQLNEGNICFVNSHLAAHMGYVEERNQDYNAIVEGIRFDDGRTIS 356
            .:|...|.:.:..||.:.||......:..|:.||..:..|.|.||..||...|:.:...  |.:.
Human   391 STVTTRIVSQIKTKGALGISFTFFGTSFLFITSHFTSGDGKVAERLLDYTRTVQALVLP--RNVP 453

  Fly   357 D--------------HDHIFWVGDLNYRIQEPPGQQRPGPLSDAQT-------------YELLLQ 394
            |              .|.:||.||.|:|            ||..:|             ...|||
Human   454 DTNPYRSSAADVTTRFDEVFWFGDFNFR------------LSGGRTVVDALLCQGLVVDVPALLQ 506

  Fly   395 YDQLRQEMRRGKCFEGYTEGEIKFRPTYKYDPGTDNYDSSEKQRAPAYCDRVLWKGTR---IEQL 456
            :|||.:|||:|..|:|:.|.:|.|.|:||:|.|.|.|||:.|||.|:|.||||::...   |..:
Human   507 HDQLIREMRKGSIFKGFQEPDIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLYRSRHKGDICPV 571

  Fly   457 AYNSIMEIRQSDHKPVYAVFQVKVKT-RDEV-----KYKR------VQEEVLKAVDKRE 503
            :|:|...|:.|||:|||.:|:|||:. ||.:     |:.|      ::..:.|.:.:::
Human   572 SYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLLGIKRRISKEIQRQQ 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 92/337 (27%)
RhoGAP_OCRL1 614..823 CDD:239845
INPP5ENP_063945.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..193
PHA03247 <2..179 CDD:223021
13 X 4 AA repeats of P-X-X-P 10..242
INPP5c_INPP5E-like 295..593 CDD:197329 92/341 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.