DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and Sh2d1b2

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_001028671.1 Gene:Sh2d1b2 / 545378 MGIID:3622649 Length:132 Species:Mus musculus


Alignment Length:134 Identity:29/134 - (21%)
Similarity:46/134 - (34%) Gaps:57/134 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 GTD-NYDSSEKQRAP-AYCDRVLWKGTRIEQLAYNSIMEIRQSDHKPVYAVFQVKVKTRDEVKYK 489
            |.| |:...:.:..| |.|..|.:|     :|.||             |.:|      |::..|.
Mouse    23 GVDGNFLIRDSESVPGALCLCVSFK-----KLVYN-------------YRIF------REKNGYY 63

  Fly   490 RVQEEVLKAVDKRENDNQPQI---NVEKTVIDFGT------VRFNEPSTR------------DFN 533
            |::.|          .:.|:.   |:|:.:..|.|      |..:.|..|            :.|
Mouse    64 RIETE----------PSTPKTIFPNLEELISKFKTPGQGMVVHLSNPIMRSGFCPGARRLNLEAN 118

  Fly   534 VYNN 537
            ||.|
Mouse   119 VYEN 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 13/52 (25%)
RhoGAP_OCRL1 614..823 CDD:239845
Sh2d1b2NP_001028671.1 SH2_SAP1 1..103 CDD:198205 24/113 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.