Protein Alignment Ocrl and Sh2d1a

DIOPT Version :9

• Sequence 1: NP_001259153.1
• Gene: Ocrl / 31157
• FlyBaseID: FBgn0023508
• Length: 850
• Species: Drosophila melanogaster
• Sequence 2: NP_001102783.2
• Gene: Sh2d1a / 501502
• RGDID: 1562408
• Length: 126
• Species: Rattus norvegicus
• Alignment Length: 47
• Identity: 11/47 - (23%)
• Similarity: 18/47 - (38%)
• Gaps: 4/47 - (8%)

  Fly     5 SEAVANGTATAATRTTKDIVKERFKEDETI----EYIFEAYQIKGPE 47
            |...|.|......|..|:::....|.|:.|    :|..|....:.|:
  Rat    65 SAETAPGVHKRFFRKVKNLISAFQKPDQGIVTPLQYPVEKSSARSPQ 111

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Ocrl	NP_001259153.1	PH-like	23..163	CDD:302622	6/29 (21%)
		INPP5c_INPP5B	185..478	CDD:197327
		RhoGAP_OCRL1	614..823	CDD:239845
Sh2d1a	NP_001102783.2	SH2_SAP1a	2..104	CDD:198263	9/38 (24%)
		Interaction with FYN SH3 domain. /evidence=ECO:0000250|UniProtKB:O88890	67..92		5/24 (21%)
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	100..126		3/12 (25%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5411
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900