DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and INPP5E

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster


Alignment Length:355 Identity:109/355 - (30%)
Similarity:159/355 - (44%) Gaps:80/355 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 SEYIVYKDIIIYCATWNVNN----KTCSDSNNPLRAWLACSEKPPDIYAIGLQELDTPTKAMLNS 237
            |..:..|:|.::..|||:|.    |..:|...|     |..|..|||..:|.|| .||.:.    
  Fly   383 SRVLPQKEITVFVGTWNMNGHSPPKQLNDFVLP-----ANVEHVPDIVVMGTQE-STPDRF---- 437

  Fly   238 TQVQAIEKQWIDKMMDSVHPDVEYEILMSHRLVATM-LTVIVRKQLRQHIIRCR-PKSVARGI-- 298
                    :|...:.:::.|.   .:|.....:.|: |.|.:|:.|   |..|. |:..:..:  
  Fly   438 --------EWEVTIQETLGPS---HVLFHATTLGTLHLAVYMRRDL---IWYCSVPEDASMSVRT 488

  Fly   299 ---FNTLGNKGGVAISLQLNEGNICFVNSHLAAHMGYVEERNQDYNAIVEGI---------RFDD 351
               |.|   ||.||||..|...::.||.|||.||...|:||..|...|:..:         |..:
  Fly   489 GSAFRT---KGAVAISFCLFGTSMLFVTSHLTAHQQKVKERVSDVKRIINALDLPRNLPNQRHKN 550

  Fly   352 GRTISDHDHIFWVGDLNYRIQEP--------PGQQRPGPLSDAQTYELLLQYDQLRQEMRRGKCF 408
            .....:.|::||.||||:|:.||        ...:.|.|......|   :..|||...:..|..|
  Fly   551 KDVTQNFDNVFWCGDLNFRLGEPREKLLEWIQNTKFPLPSHLPHGY---MHTDQLTSVLADGAAF 612

  Fly   409 EGYTEGEIKFRPTYKYDPGTDNYDSSEKQRAPAYCDRVLWK----------------------GT 451
            .|:.|..|.|.||||||||:.|:|:|.|||||||.||:|:|                      ..
  Fly   613 RGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQGLVIRRQTLVPGVSTPTQP 677

  Fly   452 RIEQLAYNSIMEIRQSDHKPVYAVFQVKVK 481
            .::.|.|:|:..|..||||||:|:|:..::
  Fly   678 HVQCLLYDSVPSITTSDHKPVWALFRTLIR 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 107/342 (31%)
RhoGAP_OCRL1 614..823 CDD:239845
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 107/345 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447416
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1399831at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.