DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and INPPL1

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:XP_024304269.1 Gene:INPPL1 / 3636 HGNCID:6080 Length:1324 Species:Homo sapiens


Alignment Length:465 Identity:113/465 - (24%)
Similarity:176/465 - (37%) Gaps:154/465 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 EVKQELKKRESEYIVYKDIIIYCATWNVNN-----------------KTCSDSNNPLRAWLACSE 214
            ::.|.:|.:.|:......|.::..|||:.:                 ||..:....:        
Human   428 QLLQLMKNKHSKQDEPDMISVFIGTWNMGSVPPPKNVTSWFTSKGLGKTLDEVTVTI-------- 484

  Fly   215 KPPDIYAIGLQELDTPTKAMLNSTQVQAIEKQWIDKMMDSVH--PDVEYEILMSHRLVATMLTVI 277
             |.|||..|.||         ||..    :::|:|.:...:.  .|::|..:....|....:.|:
Human   485 -PHDIYVFGTQE---------NSVG----DREWLDLLRGGLKELTDLDYRPIAMQSLWNIKVAVL 535

  Fly   278 VRKQLRQHIIRCRPKSVARGIFNTLGNKGGVAISLQLNEGNICFVNSHLAAHMGYVEERNQDYNA 342
            |:.:....|......||..||.|||||||.|.:|...|..:..|||.||.:.......|||:|..
Human   536 VKPEHENRISHVSTSSVKTGIANTLGNKGAVGVSFMFNGTSFGFVNCHLTSGNEKTARRNQNYLD 600

  Fly   343 IVEGIRFDDGRTISDHD------HIFWVGDLNYRIQEPPGQQRPGPLSDAQ---------TYELL 392
            |:..:...| |.::..|      |:||.||||||:.           .|.|         .:|.|
Human   601 ILRLLSLGD-RQLNAFDISLRFTHLFWFGDLNYRLD-----------MDIQEILNYISRKEFEPL 653

  Fly   393 LQYDQLRQEMRRGKCFEGYTEGEIKFRPTYKYDPGTDNYDSSEKQR-------APAYCDRVLWKG 450
            |:.|||..|..:.|.|..::|.||.|.|||:|:.|:.:..:..||:       .|::|||:|||.
Human   654 LRVDQLNLEREKHKVFLRFSEEEISFPPTYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKS 718

  Fly   451 TRIEQLAYNS--------IM---------------------------------------EIRQSD 468
            .....:..||        :|                                       :|..||
Human   719 YPETHIICNSYGQSLPDRVMGDLGWSPSGLCPNLGRWEPRVGIFPLSPHSYPLSPGCTDDIVTSD 783

  Fly   469 HKPVYAVFQVKV-----------KTRDE--VKYKRVQEEVLKAVDKR------------------ 502
            |.||:..|:|.|           ||.|:  ::::.: |.::|...:.                  
Human   784 HSPVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESI-EAIVKTASRTKFFIEFYSTCLEEYKKSF 847

  Fly   503 ENDNQPQINV 512
            |||.|...|:
Human   848 ENDAQSSDNI 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 98/380 (26%)
RhoGAP_OCRL1 614..823 CDD:239845
INPPL1XP_024304269.1 SH2_SHIP 17..119 CDD:198206
EEP 446..793 CDD:321002 98/380 (26%)
Atrophin-1 <965..1280 CDD:331285
SAM_Ship2 1260..1322 CDD:188890
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.