DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and CG9784

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster


Alignment Length:386 Identity:113/386 - (29%)
Similarity:175/386 - (45%) Gaps:71/386 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GEVKQELKKRESEYIVYKDIIIYCATWNVNNKTCSDSNNPLRAWLACSEKP------------PD 218
            |:.||:|:       .|:   :|..||||.::  ...|..||..|...:..            ||
  Fly    22 GKGKQQLE-------TYR---VYVVTWNVGSR--FPDNISLRHLLGLQDVTVDKDTKETNAHLPD 74

  Fly   219 IYAIGLQELDT-PTKAMLNSTQVQAIEKQWIDKMMDSVHPDVEYEILMSHRLVATMLTVIVRKQL 282
            |||:||||::. |.:.:|...:    |..|..|..:.:. :.:|..:.:.::...:|::.||:|.
  Fly    75 IYALGLQEVNAQPQQQVLGLFK----EDPWTHKAKELLR-NYDYVAVKTEQMQGLLLSMFVRRQH 134

  Fly   283 RQHIIRCRPKSVARGIFNTLGNKGGVAISLQLNEGNICFVNSHLAAHMGYVEERNQDYNAIVEGI 347
            .:|:.....:....|.....||||.|::...|....:.||.:||.||...::||.:||..|:|..
  Fly   135 VEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQILENH 199

  Fly   348 RF--DDGRTISDHDHIFWVGDLNYRIQEPPGQQRPGPL-SDAQTYELLLQYDQLRQEMRRGK-CF 408
            .:  ...|.|.|||::||.||||:|:|..........| .|...:|.|:|.|||.|...:.: .|
  Fly   200 HYHVKRYREIYDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQLYQVREKSQLAF 264

  Fly   409 EGYTEGEIKFRPTYKYDPGTDNYDSSEKQRAPAYCDRVLW--------KGTR--IEQLAYNSIME 463
            :...|....|.||:|:..||..||   .:|.||:.||:::        .|.:  |||.:|.|...
  Fly   265 QVLQERLPAFPPTFKFREGTSEYD---LKRRPAWTDRIMYAVQPLNRQPGMQLSIEQCSYKSHPL 326

  Fly   464 IRQSDHKPVYAVFQVKV-----------------KTRDE--VKYKRVQEEVLKAVDKREND 505
            ...||||||.:.|.:|:                 |..||  |:|.:..|     .|:..||
  Fly   327 YTISDHKPVTSDFTIKLYPNVRAPGVVFSPLSLWKIGDENTVEYHKQAE-----FDEGSND 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 98/319 (31%)
RhoGAP_OCRL1 614..823 CDD:239845
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 99/322 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447404
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105940at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11200
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.