DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and Inpp5k

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_001013881.1 Gene:Inpp5k / 287533 RGDID:1359130 Length:446 Species:Rattus norvegicus


Alignment Length:348 Identity:109/348 - (31%)
Similarity:163/348 - (46%) Gaps:54/348 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 IYCATWNVNNKT----CSD----SNNPLRAWLACSEKPPDIYAIGLQELDTPTKAMLNSTQVQAI 243
            |:..||||.:..    .||    :|..|..         |||.|||||::....::|:..   |.
  Rat    19 IHVVTWNVASAAPTVDLSDLLQLNNEDLNL---------DIYIIGLQEMNYGIISLLSDA---AF 71

  Fly   244 EKQWIDKMMDSVHPDVEYEILMSHRLVATMLTVIVRKQLRQHIIRCRPKSVARGIFNTLGNKGGV 308
            |..|....||.:.| :....:...|:...:|.|..:.|...:|.....||:..|::...|||||:
  Rat    72 EDPWSSFFMDMLSP-LNLVKISQVRMQGLLLLVFAKYQHLPYIQIISTKSIPTGLYGYWGNKGGI 135

  Fly   309 AISLQLNEGNICFVNSHLAAHMGYVEERNQDYNAIVEGIRFD--DGRTISDHDHIFWVGDLNYRI 371
            .|.|:|....:..||.||..||...::|.:.::.|:|.:.|:  |...|.|||.|.|.||:|:||
  Rat   136 NICLKLYGYYVSIVNCHLPPHMYNNDQRLEHFDRILESLTFEGYDVPNILDHDLILWFGDMNFRI 200

  Fly   372 --------QEPPGQQRPGPLSDAQTYELLLQYDQLRQEMRRGKCFEGYTEGEIKFRPTYKYDPGT 428
                    ||...::|         |:.|.:.|||....::.:....:.||.:.|.||||:|..:
  Rat   201 EDFGLLFVQECITKKR---------YKELWEKDQLFIAKKQDQLLREFQEGPLLFPPTYKFDRHS 256

  Fly   429 DNYDSSEKQRAPAYCDRVLWK-----------GTRIEQLAYNSIMEIRQSDHKPVYAVFQVKVKT 482
            :|||:|||:|.||:.||:||:           |..:.|..|.|.|....||||||...|.:::..
  Rat   257 NNYDTSEKKRKPAWTDRILWRLKRQPAKANPSGFLLTQKDYVSHMTYSISDHKPVTGTFDLELNP 321

  Fly   483 RDEVKYKRVQEEVLKAVDKREND 505
            ...|....:..|.|..   :|||
  Rat   322 LMSVPLITMMPEYLWT---KEND 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 103/319 (32%)
RhoGAP_OCRL1 614..823 CDD:239845
Inpp5kNP_001013881.1 EEP 17..317 CDD:294334 103/319 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.