DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and INPP5J

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_001271214.1 Gene:INPP5J / 27124 HGNCID:8956 Length:1006 Species:Homo sapiens


Alignment Length:340 Identity:102/340 - (30%)
Similarity:156/340 - (45%) Gaps:54/340 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 IYCATWNVNNKTCSDS-NNPLRAWLACSEKPPDIYAIGLQELDTPTKAMLNSTQVQAI-EKQWID 249
            |...||||......|. .:.|...........|:.||||||::    :|||.....|: ..||.:
Human   425 ITVVTWNVGTAMPPDDVTSLLHLGGGDDSDGADMIAIGLQEVN----SMLNKRLKDALFTDQWSE 485

  Fly   250 KMMDSVHPDVEYEILMSHRLVATMLTVIVRKQLRQHIIRCRPKSVARGIFNTLGNKGGVAISLQL 314
            ..||::.| ..:.::.|.|:...:|.:..:......:...:......|:....||||||::.|..
Human   486 LFMDALGP-FNFVLVSSVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAA 549

  Fly   315 NEGNICFVNSHLAAHMGYVEERNQDYNAIVEGIRFD--DGRTISDHDHIFWVGDLNYRIQEPPGQ 377
            ....:||:|.||.|||...|:|..::..|:...:|.  ..:.|.|||.:||.||||:||      
Human   550 FGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAQGILDHDLVFWFGDLNFRI------ 608

  Fly   378 QRPGPLSDAQTYEL--------------LLQYDQLRQEMRRGKCFEGYTEGEIKFRPTYKYDPGT 428
                     ::|:|              |.:.|||..........:|:.||.:.|.||:|:|.||
Human   609 ---------ESYDLHFVKFAIDSDQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGT 664

  Fly   429 DNYDSSEKQRAPAYCDRVLWK----------------GTRIEQLAYNSIMEIRQSDHKPVYAVFQ 477
            :.||:|.|:|.||:.||:|||                ..::.|.:|.|.||...||||||.|.|.
Human   665 NKYDTSAKKRKPAWTDRILWKVKAPGGGPSPSGRKSHRLQVTQHSYRSHMEYTVSDHKPVAAQFL 729

  Fly   478 VKVKTRDEVKYKRVQ 492
            ::...||::...|::
Human   730 LQFAFRDDMPLVRLE 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 99/324 (31%)
RhoGAP_OCRL1 614..823 CDD:239845
INPP5JNP_001271214.1 INPP5c_INPP5J-like 423..730 CDD:197328 99/324 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.