DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and Inpp5k

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:XP_006532570.1 Gene:Inpp5k / 19062 MGIID:1194899 Length:472 Species:Mus musculus


Alignment Length:352 Identity:106/352 - (30%)
Similarity:162/352 - (46%) Gaps:55/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 IYCATWNVNNKT----CSD----SNNPLRAWLACSEKPPDIYAIGLQELDTPTKAMLNSTQVQAI 243
            ::..||||.:..    .||    :|..|..         |||.|||||::....::|:..   |.
Mouse    34 VHVVTWNVASAAPTVDLSDLLQLNNQDLNL---------DIYIIGLQEMNFGIISLLSDA---AF 86

  Fly   244 EKQWIDKMMDSVHPDVEYEILMSHRLVATMLTVIVRKQLRQHIIRCRPKSVARGIFNTLGNKGGV 308
            |..|....||.:.| :.:..:...|:...:|.|..:.|...:|.....||...|::...||||||
Mouse    87 EDPWSSLFMDMLSP-LNFVKISQVRMQGLLLLVFAKYQHLPYIQIISTKSTPTGLYGYWGNKGGV 150

  Fly   309 AISLQLNEGNICFVNSHLAAHMGYVEERNQDYNAIVEGIRFD--DGRTISDHDHIFWVGDLNYRI 371
            .:.|:|....:..:|.||..||...::|.:.::.|:|.:.|:  |...|.|||.|.|.||:|:||
Mouse   151 NVCLKLYGYYVSIINCHLPPHMYNNDQRLEHFDRILESLTFEGYDVPNILDHDLILWFGDMNFRI 215

  Fly   372 QEPPGQQRPGPLSDAQT-----YELLLQYDQLRQEMRRGKCFEGYTEGEIKFRPTYKYDPGTDNY 431
            ::      .|.|...::     |:.|.:.|||....:..:....:.||.:.|.||||:|..::||
Mouse   216 ED------FGLLFVQESITRKYYKELWEKDQLFIAKKNDQLLREFQEGPLLFPPTYKFDRHSNNY 274

  Fly   432 DSSEKQRAPAYCDRVLWKGTRIEQLA------------------YNSIMEIRQSDHKPVYAVFQV 478
            |:|||:|.||:.||:||:..|....|                  |.|.|....||||||...|.:
Mouse   275 DTSEKKRKPAWTDRILWRLKRQPSQASPLASSVPTSYFLLTLKNYVSHMAYSISDHKPVTGTFDL 339

  Fly   479 KVKTRDEVKYKRVQEEVLKAVDKREND 505
            ::.....|....:..|.|..:   |||
Mouse   340 ELNPLMSVPLITMMPEHLWTM---END 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 100/323 (31%)
RhoGAP_OCRL1 614..823 CDD:239845
Inpp5kXP_006532570.1 EEP 32..339 CDD:382041 100/323 (31%)
SKICH 350..454 CDD:375315 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.