DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and inpp-1

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_001255511.1 Gene:inpp-1 / 177970 WormBaseID:WBGene00012016 Length:432 Species:Caenorhabditis elegans


Alignment Length:357 Identity:90/357 - (25%)
Similarity:168/357 - (47%) Gaps:58/357 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 IVYKDII---------IYCATWNVNNKTCSDSNNPLRAWLA------CSEKPPDIYAIGLQELDT 229
            ||..|:|         :...|||:|.|...     :.:.||      ..|...||:.|.|||:.:
 Worm    93 IVSYDVIEAMGDRKLKVCTVTWNINEKGVK-----ILSHLAQKIAERGQEMDSDIFFISLQEIPS 152

  Fly   230 --PTKAMLNSTQVQAIEKQWIDKMMDSVHPDVE-YEILMSHRLVATMLTVIVRKQLRQHIIRCRP 291
              ||               :.::.:..:.|.:. :.:.:|||..:.|:.|.:|::..::.|:.:.
 Worm   153 TAPT---------------FHEEALRILEPVLNGHRLYLSHRAWSQMVIVFIRQKHLRYAIQPQV 202

  Fly   292 KSVARG-IFNTLGNKGGVAISLQLNEGNICFVNSHLAAHMGYVEERNQDYNAIVEGIRFDDGRTI 355
            ..:|.| :...:..||.:|:.|:|.:..|..:..|| :| ...::|.|||..:|..:||......
 Worm   203 SFIASGAMAKPVRTKGAIAVCLRLYQRFIVLIGCHL-SH-ATPQQRIQDYAKVVRTLRFPQLARF 265

  Fly   356 SDH--DHIF------WVGDLNYR--IQEPPGQQRPGPLSDAQTYELLLQYDQLRQEMRRGKCFEG 410
            ..|  |.||      |:||||:|  ::.....:.|..::: :|:..:.:.::|....::...|..
 Worm   266 HAHAKDEIFGSDVVLWIGDLNFRVTVESNVDWRDPEKITE-KTFRDVFETEELASHRKKQLAFTD 329

  Fly   411 YTEGEIKFRPTYKYDPGTDNYDSSEKQRAPAYCDRVL-W--KGTRIEQLAYNSIMEIRQSDHKPV 472
            :.|..|||.||:|::|.||||   ..:|.|::.|||| |  ....::.:.|:.:.....||||.|
 Worm   330 FKEAPIKFPPTHKFEPDTDNY---VPKRIPSFTDRVLFWVRNSEWLQNIQYDCMRGTTPSDHKAV 391

  Fly   473 YAVFQVKVKTRDEVKYKRVQEEVLKAVDKREN 504
            :|.|.:.|..:...::.:.|:.:.:.:..:.|
 Worm   392 FATFWLTVINKPVPEHYKQQKSLEREISMKTN 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 84/324 (26%)
RhoGAP_OCRL1 614..823 CDD:239845
inpp-1NP_001255511.1 IPPc 105..399 CDD:214525 83/319 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.