DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and Inppl1

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_001116211.1 Gene:Inppl1 / 16332 MGIID:1333787 Length:1257 Species:Mus musculus


Alignment Length:415 Identity:116/415 - (27%)
Similarity:177/415 - (42%) Gaps:98/415 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 EVKQELKKRESEYIVYKDIIIYCATWNVNNKTCSDSNNPLRAWL-------ACSEK----PPDIY 220
            ::.|.:|.|.|:......|.::..|||:.:.....:   :.:|.       |..|.    |.|||
Mouse   407 QLLQLMKNRHSKQDEPDMISVFIGTWNMGSVPPPKN---VTSWFTSKGLGKALDEVTVTIPHDIY 468

  Fly   221 AIGLQELDTPTKAMLNSTQVQAIEKQWIDKMMDSVH--PDVEYEILMSHRLVATMLTVIVRKQLR 283
            ..|.||         ||..    :::|:|.:...:.  .|::|..:....|....:.|:|:.:..
Mouse   469 VFGTQE---------NSVG----DREWLDLLRGGLKELTDLDYRPIAMQSLWNIKVAVLVKPEHE 520

  Fly   284 QHIIRCRPKSVARGIFNTLGNKGGVAISLQLNEGNICFVNSHLAAHMGYVEERNQDYNAIVEGIR 348
            ..|......||..||.|||||||.|.:|...|..:..|||.||.:.......|||:|..|:..:.
Mouse   521 NRISHVSTSSVKTGIANTLGNKGAVGVSFMFNGTSFGFVNCHLTSGNEKTTRRNQNYLDILRLLS 585

  Fly   349 FDDGRTISDHD------HIFWVGDLNYRIQEPPGQQRPGPLSDAQ---------TYELLLQYDQL 398
            ..| |.:|..|      |:||.||||||:.           .|.|         .:|.||:.|||
Mouse   586 LGD-RQLSAFDISLRFTHLFWFGDLNYRLD-----------MDIQEILNYISRREFEPLLRVDQL 638

  Fly   399 RQEMRRGKCFEGYTEGEIKFRPTYKYDPGTDNYDSSEKQR-------APAYCDRVLWKG---TRI 453
            ..|..:.|.|..::|.||.|.|||:|:.|:.:..:..||:       .|::|||:|||.   |.|
Mouse   639 NLEREKHKVFLRFSEEEISFPPTYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHI 703

  Fly   454 EQLAYNSIMEIRQSDHKPVYAVFQVKV-----------KTRDE--VKYKRVQEEVLKAVDKR--- 502
            ...:|....:|..|||.||:..|:|.|           ||.|:  ::::.: |.::|...:.   
Mouse   704 ICNSYGCTDDIVTSDHSPVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESI-EAIVKTASRTKFF 767

  Fly   503 ---------------ENDNQPQINV 512
                           |||.|...|:
Mouse   768 IEFYSTCLEEYKKSFENDAQSSDNI 792

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 100/330 (30%)
RhoGAP_OCRL1 614..823 CDD:239845
Inppl1NP_001116211.1 SH2_SHIP 17..119 CDD:198206
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..181
INPP5c_SHIP2-INPPL1 425..728 CDD:197335 100/330 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 897..986
SH3-binding 945..950
NPXY motif 984..987
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 999..1119
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1134..1196
SAM_Ship2 1193..1255 CDD:188890
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.