DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ocrl and si:ch73-264p11.1

DIOPT Version :9

Sequence 1:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster
Sequence 2:NP_001189421.1 Gene:si:ch73-264p11.1 / 100000923 ZFINID:ZDB-GENE-120703-35 Length:143 Species:Danio rerio


Alignment Length:124 Identity:25/124 - (20%)
Similarity:47/124 - (37%) Gaps:27/124 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 KKRESEYIVYKDIIIYCATWNVNNKTCSDSNNPLRAWLACSEKPPDIYAIGLQELDTPTKAMLNS 237
            |.|:..|::                  .||.....|...|..|...:|...:.:..:.:..:..|
Zfish    22 KGRDGTYLI------------------RDSETIQGAMCLCVYKHKVVYTYRILQTHSGSFTLQAS 68

  Fly   238 TQVQAIEKQWIDKMMDSVHPDVEYEILMSHRLVATMLT-VIVRKQLRQHIIRCRPKSVA 295
            :   .:|:::...|.|.:|   .|:  .:::.:||.|. .:.||.|.|..:...|.|.|
Zfish    69 S---GVEEKFFKNMKDLIH---HYK--QNNQGLATRLRHALKRKTLPQQQLLQFPASGA 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 22/112 (20%)
RhoGAP_OCRL1 614..823 CDD:239845
si:ch73-264p11.1NP_001189421.1 SH2 4..103 CDD:301589 18/106 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.