DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Bepsilon and Y47D9A.1

DIOPT Version :9

Sequence 1:NP_569961.2 Gene:eIF2Bepsilon / 31156 FlyBaseID:FBgn0023512 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_491349.1 Gene:Y47D9A.1 / 172033 WormBaseID:WBGene00021628 Length:401 Species:Caenorhabditis elegans


Alignment Length:420 Identity:86/420 - (20%)
Similarity:136/420 - (32%) Gaps:147/420 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FKPLSDEGSTALLPLVNVRMLDYALMAL-NRSGVEEVF--------VYTSL-------YRSSIR- 69
            |:|||.:....|.|:..|.::::.:..| ..||:.|:.        |:|..       ||.||: 
 Worm    18 FRPLSLQLPKPLFPIAGVPLIEHHIDQLCQLSGLSEILLLGFFPSDVFTDFISRCQQTYRVSIKY 82

  Fly    70 --EHIRAGIATDAAWSFKM--------TVHVIGGEGCR--------------------------- 97
              |....|.|.... |||.        .|.||..:.|.                           
 Worm    83 LEEPNPLGTAGGLV-SFKKQILAGDPDAVFVINADVCGDLPIEDMGAKLDSLSGSSMLMLTTEAT 146

  Fly    98 -----CFGDAMRDLDNKALIRGHFI----------------LLGADTVTNADLRPV------LEQ 135
                 .||..:.|.:.:.:   |::                |:.|:.:...|| |:      ||.
 Worm   147 RQQSINFGSVVTDSEGRVI---HYVDKPTTFVSTNISCGVYLIKAEVIRQLDL-PLNGDGIWLET 207

  Fly   136 HKRQAKFDKGTAATLVFKECANNVRTGNEVLIAVDRRNDRLHYHQRLRMHHKENRYQLPLDVFLG 200
            .........|....|......:..:|...||.| :|...|| |.:|......:|..|:..|||:.
 Worm   208 DVLPQLASSGNLYALHTTRWWSQTKTAAAVLYA-NRHYLRL-YKRRYAARLCKNGAQIIGDVFID 270

  Fly   201 NSCVALHHNLLDPQIAIGSPSMLSLFNDNFDFQTRDDFVRGLLINEELLDSRIYVALLPAAQ--- 262
            .|........:.|.::||..|::.               :|:.|.|.:        :||.|.   
 Worm   271 PSAKVHPTAKIGPNVSIGPKSVIG---------------KGVRIKESI--------ILPEAVIEE 312

  Fly   263 ---YAHKVNNWPAYQLVSRDIINRWA----YPFVPDIGL--YKLQQEYVFHKDNIYKSPEAHVSK 318
               ....|..|       |.::..||    .|..|:..|  .|:..:.:|..|.           
 Worm   313 NACVLQSVIGW-------RSVVGMWARIEGIPLEPNPNLPFAKMDNKPLFLPDG----------- 359

  Fly   319 VALLQNVVIEAGSHVDSGSVISDSVIGANC 348
             .|..::.| .||.|   ||..:::| .||
 Worm   360 -RLTPSLTI-LGSDV---SVAPETII-LNC 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BepsilonNP_569961.2 eIF-2B_epsilon_N 9..223 CDD:133040 59/281 (21%)
GCD1 22..409 CDD:224129 86/420 (20%)
LbetaH 326..397 CDD:294107 9/23 (39%)
W2_eIF2B_epsilon 499..659 CDD:211396
Y47D9A.1NP_491349.1 M1P_guanylylT_A_like_N 5..244 CDD:133050 45/231 (19%)
LbetaH 269..336 CDD:381831 16/96 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.