| Sequence 1: | NP_001284797.1 | Gene: | Rbcn-3B / 31155 | FlyBaseID: | FBgn0023510 | Length: | 1525 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_014146.1 | Gene: | TEX1 / 855468 | SGDID: | S000005197 | Length: | 422 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 210 | Identity: | 49/210 - (23%) |
|---|---|---|---|
| Similarity: | 73/210 - (34%) | Gaps: | 69/210 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1332 INT----PLTQSVLHKAKGEILQCVEMLIDKMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELC 1392
Fly 1393 PAICKFNQISHCAQTRRIAVGANSGNLAIYELRQ---NKCQMIPAHTHPITSLAFSPDGKYLVSY 1454
Fly 1455 S-------------CAE---NRLSFWQTSTGMFGLGQSQTRCTK--------------------- 1482
Fly 1483 GYSTAPI----PDVS 1493 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Rbcn-3B | NP_001284797.1 | WD40 | <11..>204 | CDD:225201 | |
| WD40 repeat | 20..63 | CDD:293791 | |||
| WD40 | <22..202 | CDD:295369 | |||
| WD40 repeat | 68..107 | CDD:293791 | |||
| WD40 repeat | 118..152 | CDD:293791 | |||
| WD40 repeat | 160..204 | CDD:293791 | |||
| WD40 repeat | 212..251 | CDD:293791 | |||
| WD40 repeat | 406..459 | CDD:293791 | |||
| WD40 | <449..>607 | CDD:225201 | |||
| WD40 | 453..>597 | CDD:295369 | |||
| WD40 repeat | 513..555 | CDD:293791 | |||
| WD40 repeat | 560..596 | CDD:293791 | |||
| WD40 | <1395..>1469 | CDD:225201 | 26/92 (28%) | ||
| WD40 | <1399..1495 | CDD:295369 | 36/139 (26%) | ||
| WD40 repeat | 1439..1466 | CDD:293791 | 9/42 (21%) | ||
| TEX1 | NP_014146.1 | WD40 | 1..>374 | CDD:225201 | 49/210 (23%) |
| WD40 repeat | 66..109 | CDD:293791 | |||
| WD40 repeat | 116..158 | CDD:293791 | |||
| WD40 repeat | 163..205 | CDD:293791 | 11/45 (24%) | ||
| WD40 repeat | 213..249 | CDD:293791 | 11/41 (27%) | ||
| WD40 repeat | 256..290 | CDD:293791 | 7/33 (21%) | ||
| WD40 repeat | 298..336 | CDD:293791 | 5/37 (14%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||