Sequence 1: | NP_001284797.1 | Gene: | Rbcn-3B / 31155 | FlyBaseID: | FBgn0023510 | Length: | 1525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_012962.3 | Gene: | CAF4 / 853908 | SGDID: | S000001744 | Length: | 643 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 465 | Identity: | 71/465 - (15%) |
---|---|---|---|
Similarity: | 145/465 - (31%) | Gaps: | 171/465 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 683 PLVIQGLRTNPKDAESHILFFDIEGLIFELHSEEYAQMTPAT----------------LESLGVH 731
Fly 732 LQNPKDGKSMHLDASKKIGDFFNKVKNKAVDVEKILKDKDKHGL-----VQKFKEKTEIVEK-KV 790
Fly 791 QA-KVESLQKAVE------------------------------------PHEEQQDLKSKIASKM 818
Fly 819 EVTHVMEVAQLLLSLLHSWGLDPHLDKMCETRLGLLRPIVPISYGVLSKAGYMSLLLPTWQNNYA 883
Fly 884 IPPGIQLPSS---------SKKR-----------------------------PLPEELQRL---- 906
Fly 907 --------EHLTAV-FTSR-----------LHWELSTTLTTNHILALVAMSNTLLSMSAASF--- 948
Fly 949 -------------------------------LPDSEKHKKLQRLAQRTDSTLSNEEEREELMAHH 982
Fly 983 ISQIKHAWSL 992 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rbcn-3B | NP_001284797.1 | WD40 | <11..>204 | CDD:225201 | |
WD40 repeat | 20..63 | CDD:293791 | |||
WD40 | <22..202 | CDD:295369 | |||
WD40 repeat | 68..107 | CDD:293791 | |||
WD40 repeat | 118..152 | CDD:293791 | |||
WD40 repeat | 160..204 | CDD:293791 | |||
WD40 repeat | 212..251 | CDD:293791 | |||
WD40 repeat | 406..459 | CDD:293791 | |||
WD40 | <449..>607 | CDD:225201 | |||
WD40 | 453..>597 | CDD:295369 | |||
WD40 repeat | 513..555 | CDD:293791 | |||
WD40 repeat | 560..596 | CDD:293791 | |||
WD40 | <1395..>1469 | CDD:225201 | |||
WD40 | <1399..1495 | CDD:295369 | |||
WD40 repeat | 1439..1466 | CDD:293791 | |||
CAF4 | NP_012962.3 | Caf4 | 65..124 | CDD:402971 | 2/15 (13%) |
WD40 | 318..641 | CDD:238121 | 40/247 (16%) | ||
WD40 repeat | 322..360 | CDD:293791 | 11/45 (24%) | ||
WD40 repeat | 366..422 | CDD:293791 | 5/55 (9%) | ||
WD40 repeat | 427..461 | CDD:293791 | 8/33 (24%) | ||
WD40 repeat | 472..526 | CDD:293791 | 6/53 (11%) | ||
WD40 repeat | 532..563 | CDD:293791 | 5/25 (20%) | ||
WD40 repeat | 571..611 | CDD:293791 | |||
WD40 repeat | 617..641 | CDD:293791 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |