DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbcn-3B and CAF4

DIOPT Version :9

Sequence 1:NP_001284797.1 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_012962.3 Gene:CAF4 / 853908 SGDID:S000001744 Length:643 Species:Saccharomyces cerevisiae


Alignment Length:465 Identity:71/465 - (15%)
Similarity:145/465 - (31%) Gaps:171/465 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 PLVIQGLRTNPKDAESHILFFDIEGLIFELHSEEYAQMTPAT----------------LESLGVH 731
            |.:.:|.:......:..:|..:::|.. ....|:|.|:....                ||.:..:
Yeast   108 PSLFEGFKATVSIIQQRLLLDNVDGAT-NSDKEKYVQLPDINTGFVNKTYSRIDLTHLLEDVETN 171

  Fly   732 LQNPKDGKSMHLDASKKIGDFFNKVKNKAVDVEKILKDKDKHGL-----VQKFKEKTEIVEK-KV 790
            ::|....|::.:|...::....|:::::.:.:.:.:|..|....     |...|::...:|: .:
Yeast   172 VENLSINKTLEMDELTRLDSMINELESRKLKILERVKHIDSKSTNLENDVTLIKDRINFIEEYNL 236

  Fly   791 QA-KVESLQKAVE------------------------------------PHEEQQDLKSKIASKM 818
            :| :.:||:|.:|                                    |||:..|...:|.|: 
Yeast   237 EADREQSLRKQMEEERSSEASSFTQNEEAISSLCDVESKDTRLKDFYKMPHEKSHDKNRQIISE- 300

  Fly   819 EVTHVMEVAQLLLSLLHSWGLDPHLDKMCETRLGLLRPIVPISYGVLSKAGYMSLLLPTWQNNYA 883
              |:........:::.|.    .|.:.:  |.|....|     :|.|..:.|...::..|..|:.
Yeast   301 --TYSRNTTAFRMTIPHG----EHGNSI--TALDFDTP-----WGTLCSSSYQDRIVKVWDLNHG 352

  Fly   884 IPPGIQLPSS---------SKKR-----------------------------PLPEELQRL---- 906
            |..| :||..         .||.                             ||.|:.:.:    
Yeast   353 IQVG-ELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPC 416

  Fly   907 --------EHLTAV-FTSR-----------LHWELSTTLTTNHILALVAMSNTLLSMSAASF--- 948
                    :.:||: |.|.           .||:|:|......:..:...:::.:.|.|.|.   
Yeast   417 IHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNG 481

  Fly   949 -------------------------------LPDSEKHKKLQRLAQRTDSTLSNEEEREELMAHH 982
                                           |.|....|.::.|...||...|.:.:.|:|:...
Yeast   482 ACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGS 546

  Fly   983 ISQIKHAWSL 992
            :......|.|
Yeast   547 MDNSVRIWDL 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791
WD40 <449..>607 CDD:225201
WD40 453..>597 CDD:295369
WD40 repeat 513..555 CDD:293791
WD40 repeat 560..596 CDD:293791
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
CAF4NP_012962.3 Caf4 65..124 CDD:402971 2/15 (13%)
WD40 318..641 CDD:238121 40/247 (16%)
WD40 repeat 322..360 CDD:293791 11/45 (24%)
WD40 repeat 366..422 CDD:293791 5/55 (9%)
WD40 repeat 427..461 CDD:293791 8/33 (24%)
WD40 repeat 472..526 CDD:293791 6/53 (11%)
WD40 repeat 532..563 CDD:293791 5/25 (20%)
WD40 repeat 571..611 CDD:293791
WD40 repeat 617..641 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.