Sequence 1: | NP_001284797.1 | Gene: | Rbcn-3B / 31155 | FlyBaseID: | FBgn0023510 | Length: | 1525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_012423.1 | Gene: | MDV1 / 853332 | SGDID: | S000003648 | Length: | 714 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 293 | Identity: | 75/293 - (25%) |
---|---|---|---|
Similarity: | 112/293 - (38%) | Gaps: | 77/293 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 LWGPTAPTHCISSVFLSDDQFTLVTGCYDGQICLWQV--------------EPTTLKMSPRCL-- 60
Fly 61 LVGHSAPVLCLVRASLLPENNFLVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQIQSYHTANSED 125
Fly 126 VRLFCIGYYAEIMVMDPFSLEVIYVLSSKVKPDW-ISAIHVLRPMRRKDDVVL------AITTTG 183
Fly 184 ----TVKVWTL-TGNENK-HA---------------------EP---IYENESKEIRCLNAITMN 218
Fly 219 CCAQ-NQRTVLLVCTKYWQIY-----DAGDFTV 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rbcn-3B | NP_001284797.1 | WD40 | <11..>204 | CDD:225201 | 63/244 (26%) |
WD40 repeat | 20..63 | CDD:293791 | 15/58 (26%) | ||
WD40 | <22..202 | CDD:295369 | 57/232 (25%) | ||
WD40 repeat | 68..107 | CDD:293791 | 16/38 (42%) | ||
WD40 repeat | 118..152 | CDD:293791 | 4/33 (12%) | ||
WD40 repeat | 160..204 | CDD:293791 | 20/79 (25%) | ||
WD40 repeat | 212..251 | CDD:293791 | 10/40 (25%) | ||
WD40 repeat | 406..459 | CDD:293791 | |||
WD40 | <449..>607 | CDD:225201 | |||
WD40 | 453..>597 | CDD:295369 | |||
WD40 repeat | 513..555 | CDD:293791 | |||
WD40 repeat | 560..596 | CDD:293791 | |||
WD40 | <1395..>1469 | CDD:225201 | |||
WD40 | <1399..1495 | CDD:295369 | |||
WD40 repeat | 1439..1466 | CDD:293791 | |||
MDV1 | NP_012423.1 | Mdv1 | 123..171 | CDD:402923 | |
WD40 | 397..713 | CDD:238121 | 75/293 (26%) | ||
WD40 repeat | 402..439 | CDD:293791 | 1/1 (100%) | ||
WD40 repeat | 444..499 | CDD:293791 | 15/58 (26%) | ||
WD40 repeat | 506..539 | CDD:293791 | 15/37 (41%) | ||
WD40 repeat | 546..603 | CDD:293791 | 9/56 (16%) | ||
WD40 repeat | 648..683 | CDD:293791 | 7/41 (17%) | ||
WD40 repeat | 690..712 | CDD:293791 | 7/24 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |