DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbcn-3B and SKI8

DIOPT Version :9

Sequence 1:NP_001284797.1 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_011302.1 Gene:SKI8 / 852659 SGDID:S000003181 Length:397 Species:Saccharomyces cerevisiae


Alignment Length:252 Identity:48/252 - (19%)
Similarity:78/252 - (30%) Gaps:92/252 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1240 RRAAIDLLGRGFTVWE--PYLDVSKVLLGLLEISCEGKAVPNLNY----------KLPLTPQADA 1292
            |..|.|:.|..: :|:  |:.|.|..|              .||:          :.|:||...|
Yeast   140 RLVATDVKGTTY-IWKFHPFADESNSL--------------TLNWSPTLELQGTVESPMTPSQFA 189

  Fly  1293 CRTARHALRLIATA--RPAAFITTMAREVARYNTMQQNAQSINTPLTQSVLHKAKGEILQ----- 1350
            .........||||.  .....|:.::.....||...|::...|:...:||....:|.:|.     
Yeast   190 TSVDISERGLIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVKFSPQGSLLAIAHDS 254

  Fly  1351 ----CVEMLIDKMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQISHCAQTRRIA 1411
                |:.:...:....|..|.|.                                :|.:|     
Yeast   255 NSFGCITLYETEFGERIGSLSVP--------------------------------THSSQ----- 282

  Fly  1412 VGANSGNLAIYELRQNKCQMIPAHTHPITSLAFSPDGKYLVSYSCAENRLSFWQTST 1468
              |:.|..              ||:..:.||:|:..|:.|.|... :.:|.||...|
Yeast   283 --ASLGEF--------------AHSSWVMSLSFNDSGETLCSAGW-DGKLRFWDVKT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791
WD40 <449..>607 CDD:225201
WD40 453..>597 CDD:295369
WD40 repeat 513..555 CDD:293791
WD40 repeat 560..596 CDD:293791
WD40 <1395..>1469 CDD:225201 16/74 (22%)
WD40 <1399..1495 CDD:295369 16/70 (23%)
WD40 repeat 1439..1466 CDD:293791 9/26 (35%)
SKI8NP_011302.1 WD40 13..351 CDD:421866 48/252 (19%)
WD40 repeat 19..60 CDD:293791
WD40 repeat 66..119 CDD:293791
WD40 repeat 124..180 CDD:293791 11/54 (20%)
WD40 repeat 190..224 CDD:293791 7/33 (21%)
WD40 repeat 236..275 CDD:293791 6/38 (16%)
WD40 repeat 294..330 CDD:293791 10/30 (33%)
WD40 repeat 357..391 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.