DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbcn-3B and Poc1

DIOPT Version :9

Sequence 1:NP_001284797.1 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001261799.1 Gene:Poc1 / 39502 FlyBaseID:FBgn0036354 Length:403 Species:Drosophila melanogaster


Alignment Length:394 Identity:76/394 - (19%)
Similarity:130/394 - (32%) Gaps:120/394 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 SLLHRFCVHAGEITQLLVPPESCSPRILKCICSVASDHSVTLVSL-QERKCVTLASRHLFPVVTI 563
            :|...|..|:|.||||...|:...      |.:.::|.:|.|.:| |..:|:..|| |..||..:
  Fly     9 ALERHFTGHSGGITQLRFGPDGAQ------IATSSTDSTVILWNLNQAARCIRFAS-HSAPVNGV 66

  Fly   564 KWRPLDDFLIVGCSDGSVYVWQME----------------------TGHLDRVLHGMLAEEVLSA 606
            .|.|..:.:.....|.:|.:|:.:                      ||||           :|:|
  Fly    67 AWSPKGNLVASAGHDRTVKIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHL-----------MLTA 120

  Fly   607 CDE------------------QAEDGGSGGGGGSNG---ASASEMGMANPAVHFF---RGLKSRN 647
            .|:                  |..:.........||   |:||:    :.:|..:   .|...|.
  Fly   121 SDDKSAKIWRVARRQFVSSFAQQNNWVRSAKFSPNGKLVATASD----DKSVRIYDVDSGECVRT 181

  Fly   648 MNAIRHATQRGITQLQQLQGHNQGNFDFLMKHRSNPLVIQGLRTNPKDAESHILFFDIEG-LIFE 711
            ....|.|.       :||..|..||           ::...|..|      .|..||:.| .:.:
  Fly   182 FTEERAAP-------RQLAWHPWGN-----------MLAVALGCN------RIKIFDVSGSQLLQ 222

  Fly   712 LHSEEYAQMTPATLESLGVHLQNPKDGKSM----------------HLDASKKI-----GDFFNK 755
            |:....|.:........|..|.:..|.:::                |.||...:     ||   |
  Fly   223 LYVVHSAPVNDVAFHPSGHFLLSGSDDRTIRILDLLEGRPIYTLTGHTDAVNAVAFSRDGD---K 284

  Fly   756 VKNKAVDVEKILKDKDKHGL-VQKFKEKTEIVEKKVQAK-VESLQKAVEPHEEQQDLKSKIASKM 818
            ......|.:.::...:.|.. ..:|:.|:.:.....::. |.|.|.......:..||..:|..:.
  Fly   285 FATGGSDRQLLVWQSNLHTYDASQFEAKSALASSSCESSGVSSKQSEGSSTSKSNDLSIRIDPRQ 349

  Fly   819 EVTH 822
            .:.:
  Fly   350 SLAY 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791
WD40 <449..>607 CDD:225201 31/129 (24%)
WD40 453..>597 CDD:295369 30/119 (25%)
WD40 repeat 513..555 CDD:293791 12/42 (29%)
WD40 repeat 560..596 CDD:293791 10/57 (18%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
Poc1NP_001261799.1 WD40 10..298 CDD:238121 67/336 (20%)
WD40 14..388 CDD:225201 75/389 (19%)
WD40 repeat 22..58 CDD:293791 11/41 (27%)
WD40 repeat 63..99 CDD:293791 6/35 (17%)
WD40 repeat 106..140 CDD:293791 7/44 (16%)
WD40 repeat 147..183 CDD:293791 8/39 (21%)
WD40 repeat 189..224 CDD:293791 11/58 (19%)
WD40 repeat 231..254 CDD:293791 3/22 (14%)
WD40 repeat 273..297 CDD:293791 4/26 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.