DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbcn-3B and Lis-1

DIOPT Version :9

Sequence 1:NP_001284797.1 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001246361.1 Gene:Lis-1 / 36791 FlyBaseID:FBgn0015754 Length:411 Species:Drosophila melanogaster


Alignment Length:158 Identity:30/158 - (18%)
Similarity:65/158 - (41%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 KQNFSDW----PSHQILYGHRGRVNCLLCPSMIHSRYEKSHLLSGGIDFAVCLWDLYSGSLLHRF 505
            |:...:|    |....|.|||..:..::    .|..:  :.::|...|..:.:||..:|......
  Fly    88 KRTPGEWIPRPPEKFSLTGHRASITRVI----FHPIF--ALMVSASEDATIRIWDFETGEYERSL 146

  Fly   506 CVHAGEITQLLVPPESCSPRILKCICSVASDHSVTLVSLQER-KCVTLASRHLFPVVTIKWRPLD 569
            ..|...:..:....:.      |.:.|.::|.|:.|...|:. :|:.....|...|.::.:.|..
  Fly   147 KGHTDSVQDVAFDAQG------KLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAG 205

  Fly   570 DFLIVGCSDGSVYVWQMETGHLDRVLHG 597
            |:::....|.::.:|::.||:..:...|
  Fly   206 DYVLSASRDRTIKMWEVATGYCVKTYTG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791 4/17 (24%)
WD40 <449..>607 CDD:225201 29/154 (19%)
WD40 453..>597 CDD:295369 26/144 (18%)
WD40 repeat 513..555 CDD:293791 7/42 (17%)
WD40 repeat 560..596 CDD:293791 7/35 (20%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
Lis-1NP_001246361.1 LisH 9..40 CDD:128913
WD40 100..409 CDD:238121 27/146 (18%)
WD40 repeat 111..148 CDD:293791 6/42 (14%)
WD40 repeat 154..191 CDD:293791 7/42 (17%)
WD40 repeat 196..232 CDD:293791 7/35 (20%)
WD40 repeat 239..274 CDD:293791
WD40 repeat 280..336 CDD:293791
WD40 repeat 342..378 CDD:293791
WD40 repeat 384..408 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.