DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbcn-3B and Wdr81

DIOPT Version :9

Sequence 1:NP_001284797.1 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster


Alignment Length:423 Identity:89/423 - (21%)
Similarity:143/423 - (33%) Gaps:132/423 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ICLWQVEPTTLKMSPRCL---------LVGHSAPVLCLVRASLLPENNFLVSSSENGEMCTWDLT 98
            :..|:.|.|..:...:.|         .|||:..|..:.  :|..||:| :|:|::..:..|.|.
  Fly  1627 LAYWRNETTRNEKDTQTLNLKQIRLQSFVGHTNSVRAIY--ALDNENSF-ISASKDKTVKLWSLR 1688

  Fly    99 ---DGKCMEAVKLPQVHTQIQSYHTANSEDVR--------LFCIGYYAEIMVMDPFSLEVIYVLS 152
               ||:...|         .|..:||:.:.:.        .:.:...:.|.:.|||....:.||.
  Fly  1689 SEGDGRKTSA---------CQFTYTAHKKSINSLGFLESLRYVVSCDSGIHLWDPFIGRPLSVLD 1744

  Fly   153 SKVKPDWISAIHVLRPMRRKDDVVLAITTTGTVKVWTLTGNENKHAEPIYENESKEIRCLNAITM 217
            :...    ||:.|::.:.....:|:|.|...|||:......|       |.||            
  Fly  1745 APRH----SAVTVVKCLPSHSPLVIAGTAESTVKMVDARSCE-------YVNE------------ 1786

  Fly   218 NCCAQNQRTVLLVCTKYWQIYDAG--DFTVLCSVIAPARERWQGGDFITSDRVMLWTDEGKGYLY 280
                             |::.:|.  :.||.|..:||: ..|......:...|.|.|..|.....
  Fly  1787 -----------------WRVCNASLPNATVRCLAVAPS-GNWLAAGLSSGCIVQLDTRTGMVINS 1833

  Fly   281 KLPANCIPDNKEFHSKSVVRDAPYLYYVLQHAGDKVLSCPPAMKLLQGAGGQHNLLRGDSEGYIS 345
            ..|..|                           |.:....|:.:.|..:...|:|         :
  Fly  1834 WRPMEC---------------------------DLLQLAAPSDQFLVSSALDHSL---------A 1862

  Fly   346 VWNVPEVPLDNISILQAKQMPPRP--LKPHVCTSLVEAWSIMDPPPVGILDQL------SRITES 402
            ||:.    ||.|...|.|. ||.|  ....|..|||.|.:   ...||:...:      |.||:.
  Fly  1863 VWHA----LDGIMHYQLKP-PPEPAHFLQSVGPSLVYATT---GNRVGVYADVAHSHAFSTITKL 1919

  Fly   403 PVK-----LTSSIYLPQQSRLVIGREDGSIVIV 430
            ..:     |||...||.....:.|.|.|:|.::
  Fly  1920 RSETFRGVLTSLAVLPLNRAFLAGNESGNIALL 1952

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201 39/180 (22%)
WD40 repeat 20..63 CDD:293791 4/28 (14%)
WD40 <22..202 CDD:295369 38/178 (21%)
WD40 repeat 68..107 CDD:293791 12/41 (29%)
WD40 repeat 118..152 CDD:293791 7/41 (17%)
WD40 repeat 160..204 CDD:293791 11/43 (26%)
WD40 repeat 212..251 CDD:293791 5/40 (13%)
WD40 repeat 406..459 CDD:293791 9/25 (36%)
WD40 <449..>607 CDD:225201
WD40 453..>597 CDD:295369
WD40 repeat 513..555 CDD:293791
WD40 repeat 560..596 CDD:293791
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
Wdr81NP_609535.1 Beach 345..588 CDD:100117
WD40 <1644..1877 CDD:225201 63/325 (19%)
WD40 1651..1876 CDD:295369 62/317 (20%)
WD40 repeat 1662..1705 CDD:293791 12/54 (22%)
WD40 repeat 1710..1744 CDD:293791 5/33 (15%)
WD40 repeat 1752..1788 CDD:293791 11/71 (15%)
WD40 repeat 1799..1836 CDD:293791 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.