DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbcn-3B and LOC100332173

DIOPT Version :9

Sequence 1:NP_001284797.1 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:XP_002667373.4 Gene:LOC100332173 / 100332173 -ID:- Length:276 Species:Danio rerio


Alignment Length:280 Identity:135/280 - (48%)
Similarity:195/280 - (69%) Gaps:16/280 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1258 LDVSKVLLGLLEISCEG-KAVPNLNYKLPLTPQADACRTARHALRLIATARPAAFITTMAREVAR 1321
            :|||.||:||||:..:. |.:.|::..|||:|.||:.|:|||||.|||||||.|||||:||||.|
Zfish     1 MDVSAVLMGLLELCADAEKQLSNISMGLPLSPAADSARSARHALSLIATARPPAFITTIAREVHR 65

  Fly  1322 YNTMQ----QNAQSINTPLTQSVLHKAKGEILQCVEMLIDKMQSEIAGLLVEVMDIALHCVDGNE 1382
            :..||    |:.|:|:|    :.|.:||.|||:.:|:||:||.|::..||||||||.::|::|:.
Zfish    66 HTAMQSQGSQSQQNIHT----TTLARAKTEILRVIEILIEKMPSDVVDLLVEVMDIIMYCIEGSL 126

  Fly  1383 LKNRGLAELCPAICKFNQISHCAQTRRIAVGANSGNLAIYELRQNKCQMIPAHTHPITSLAFSPD 1447
            :|.:||:|..||||:|..:::|.::.||||||..|::|:|::|..|||.|..|..|||:::|:||
Zfish   127 VKKKGLSECFPAICRFYMVAYCERSYRIAVGARQGSVALYDVRTGKCQHIHGHKGPITAVSFAPD 191

  Fly  1448 GKYLVSYSCAENRLSFWQTSTGMFG-LGQ----SQTRCTKGYSTAPIPDVS--RLNPMRLAKLVW 1505
            |:||.:||.|::.:||||.:|.:.| :|.    .|.||.|.|...|:...|  ..|.::||:|:|
Zfish   192 GRYLATYSNADSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQPASPGSQNALKLARLIW 256

  Fly  1506 INNRTVTLMLADGSETRFNV 1525
            .:||.|.||..||.|.||.|
Zfish   257 TSNRNVILMAHDGKEHRFMV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791
WD40 <449..>607 CDD:225201
WD40 453..>597 CDD:295369
WD40 repeat 513..555 CDD:293791
WD40 repeat 560..596 CDD:293791
WD40 <1395..>1469 CDD:225201 35/73 (48%)
WD40 <1399..1495 CDD:295369 42/102 (41%)
WD40 repeat 1439..1466 CDD:293791 14/26 (54%)
LOC100332173XP_002667373.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12154
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D331603at33208
OrthoFinder 1 1.000 - - FOG0002541
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104321
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.