DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment arm and FUR1

DIOPT Version :9

Sequence 1:	NP_001259149.1	Gene:	arm / 31151	FlyBaseID:	FBgn0000117	Length:	843	Species:	Drosophila melanogaster
Sequence 2:	NP_011996.2	Gene:	FUR1 / 856529	SGDID:	S000001170	Length:	216	Species:	Saccharomyces cerevisiae

Alignment Length:	111	Identity:	23/111 - (20%)
Similarity:	47/111 - (42%)	Gaps:	25/111 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly    73 DLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPS 137
            |.:|..|:.|.:...:|:        |:|....:.|.....|..|.:|:      ..::|..:|.
Yeast   111 DEETALPKLFYEKLPEDI--------SERYVFLLDPMLATGGSAIMATE------VLIKRGVKPE 161

  Fly   138 QMLKHAVVNLINYQDDAELATRAIPELIKLLN-------DEDQVVV 176
            ::.   .:|||..::..|....|.|| ::::.       ||::.:|
Yeast   162 RIY---FLNLICSKEGIEKYHAAFPE-VRIVTGALDRGLDENKYLV 203

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
arm	NP_001259149.1	Adaptin_N	<150..>314	CDD:331138	7/34 (21%)
		armadillo repeat	161..186	CDD:293788	5/23 (22%)
		armadillo repeat	193..231	CDD:293788
		armadillo repeat	238..270	CDD:293788
		armadillo repeat	278..314	CDD:293788
		armadillo repeat	320..355	CDD:293788
		Arm	361..398	CDD:278915
		armadillo repeat	362..397	CDD:293788
		armadillo repeat	410..435	CDD:293788
		Arm	439..481	CDD:278915
		armadillo repeat	443..481	CDD:293788
		armadillo repeat	490..525	CDD:293788
		Arm	597..636	CDD:278915
		armadillo repeat	600..636	CDD:293788
		armadillo repeat	641..675	CDD:293788
FUR1	NP_011996.2	UPRTase	14..214	CDD:405383	23/111 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0572
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900