DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and NRK1

DIOPT Version :10

Sequence 1:NP_476665.2 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_014270.1 Gene:NRK1 / 855594 SGDID:S000005073 Length:240 Species:Saccharomyces cerevisiae


Alignment Length:223 Identity:37/223 - (16%)
Similarity:69/223 - (30%) Gaps:64/223 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TMSHNNQYNPPDLPPMVSAKEQTLMW------------------QQNSYLGDSGIHSGAV----- 51
            |:.|.:.:...|....|.||.....|                  :|...:....||:..|     
Yeast    34 TLIHEDDFYKHDNEVPVDAKYNIQNWDSPEALDFKLFGKELDVIKQTGKIATKLIHNNNVDDPFT 98

  Fly    52 -------------TQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMN-------QQLSQ 96
                         .:..|::..:.|.:..|..|...:||..:.|      |:.       :.|.:
Yeast    99 KFHIDRQVWDELKAKYDSINDDKYEVVIVDGFMIFNNTGISKKF------DLKILVRAPYEVLKK 157

  Fly    97 TRSQRVRAAMFPETLEEGIE-IPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRA 160
            .|:.|           :|.: :.|...||  |.........|....||.: .:|...:..|..|.
Yeast   158 RRASR-----------KGYQTLDSFWVDP--PYYFDEFVYESYRANHAQL-FVNGDVEGLLDPRK 208

  Fly   161 IPELIKLLNDEDQVVVSQAAMMVHQLSK 188
            ...:.:.:||:|..:....:.:..::.|
Yeast   209 SKNIKEFINDDDTPIAKPLSWVCQEILK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_476665.2 CTNNAbd_dArm 85..159 CDD:439243 14/81 (17%)
Adaptin_N <150..>314 CDD:396262 6/39 (15%)
armadillo repeat 161..186 CDD:293788 3/24 (13%)
armadillo repeat 193..231 CDD:293788
armadillo repeat 238..270 CDD:293788
armadillo repeat 278..314 CDD:293788
armadillo repeat 320..355 CDD:293788
Arm 361..398 CDD:425727
armadillo repeat 362..397 CDD:293788
armadillo repeat 410..435 CDD:293788
Arm 439..481 CDD:425727
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:425727
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
NRK1NP_014270.1 NRK1 8..198 CDD:238982 30/183 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.