DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and PUB45

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_174112.1 Gene:PUB45 / 839684 AraportID:AT1G27910 Length:768 Species:Arabidopsis thaliana


Alignment Length:448 Identity:102/448 - (22%)
Similarity:162/448 - (36%) Gaps:119/448 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 NQQLSQ---TRSQRVRAAMFPETLEEGIEIP------------------STQFDPQ--------- 125
            :||||.   |.:..|:|.:.....:.|:::|                  |...|.:         
plant   324 HQQLSHLCLTPNYCVKALISSWCEQNGVQVPDGPPESLDLNYWRLALSVSESTDTRSAKRVGSCK 388

  Fly   126 -QPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQV-----VVSQAAMMVH 184
             :...|..|.|...:.:.|..:  .||:|.........||:..|.|.|.:     ||.|    :.
plant   389 LKDVKVVPLEESGTIKEEACES--EYQEDQVTLVERCTELLTTLTDVDTLRKKCRVVEQ----IR 447

  Fly   185 QLSKKEASRHAIMNSPQMVAALVRAIS---NSNDLESTKAAVGTLHNL----SHHRQGLLAIFKS 242
            .|.|.:.....:|.....|.||::.:.   |.|:..:.|.....|.||    :.:::.:||   |
plant   448 VLLKDDEEARILMGENGCVEALLQFLGSALNENNASAQKVGAMALFNLAVDNNRNKELMLA---S 509

  Fly   243 GGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTD 307
            |.||.|.::|.:|                 |..||..|:.|              |:       .
plant   510 GIIPLLEEMLCNP-----------------HSHGSVTAIYL--------------NL-------S 536

  Fly   308 CLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRV-LKV--------LSVCSSNKP 363
            ||       :|:|.:|    |.:..|..|     ..||||.:.| .||        ||....|.|
plant   537 CL-------EEAKPVI----GSSLAVPFM-----VNLLWTETEVQCKVDALHSLFHLSTYPPNIP 585

  Fly   364 AIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNL-SDAATKVEGLEA--LLQSLVQVLGSTDVNVV 425
            .::.|..:.||.....:...|..:..|..|.|| .:.|.|.|.:.|  |:.:|..:|.:.:.|..
plant   586 CLLSADLVNALQSLTISDEQRWTEKSLAVLLNLVLNEAGKDEMVSAPSLVSNLCTILDTGEPNEQ 650

  Fly   426 TCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDR-EEITEPAVCALRHLTSR 482
            ..|..:|..|..:::.....|.|.|.:.:||...:|...| .|..:..:...|.|..|
plant   651 EQAVSLLLILCNHSEICSEMVLQEGVIPSLVSISVNGTQRGRERAQKLLTLFRELRQR 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 40/175 (23%)
armadillo repeat 161..186 CDD:293788 8/29 (28%)
armadillo repeat 193..231 CDD:293788 10/44 (23%)
armadillo repeat 238..270 CDD:293788 8/31 (26%)
armadillo repeat 278..314 CDD:293788 5/35 (14%)
armadillo repeat 320..355 CDD:293788 12/43 (28%)
Arm 361..398 CDD:278915 10/37 (27%)
armadillo repeat 362..397 CDD:293788 9/35 (26%)
armadillo repeat 410..435 CDD:293788 5/24 (21%)
Arm 439..481 CDD:278915 10/42 (24%)
armadillo repeat 443..481 CDD:293788 10/38 (26%)
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:278915
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
PUB45NP_174112.1 Ubox 282..345 CDD:128780 7/20 (35%)
armadillo repeat 415..449 CDD:293788 9/37 (24%)
armadillo repeat 457..497 CDD:293788 10/39 (26%)
PLN03200 <638..>700 CDD:215629 14/61 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.