DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and PUB38

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_201323.1 Gene:PUB38 / 836643 AraportID:AT5G65200 Length:556 Species:Arabidopsis thaliana


Alignment Length:424 Identity:90/424 - (21%)
Similarity:160/424 - (37%) Gaps:105/424 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QYNPPDLPPMVSAKEQTLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQ 80
            |..|||:...||  ||.|:             .....:.|.:....|.|:.|.            
plant   125 QMPPPDVEIRVS--EQELL-------------RAVAHRAPMIIHHADSELMGR------------ 162

  Fly    81 NFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVV 145
                   .|.|.  |.|.|            :|.:.:..:.|.|...|.......||.....:.:
plant   163 -------RDFNN--STTSS------------DESVIVAHSPFTPLPLTTRPACFSPSPSSSSSEI 206

  Fly   146 NLINYQDDAELATRAIPELIKLLNDEDQVVVS-----------QAAMMVHQLSKKEASRHAIMNS 199
            ..:.:......:|....|       ||:|:.:           |..:|:.::::........:.|
plant   207 ETLTHHTFFSNSTSTATE-------EDEVIYNKLKSSEIFDQEQGLIMMRKMTRTNDEARVSLCS 264

  Fly   200 PQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAI 264
            |::::.|...|.:...|..|. |:.:|.|||..::..|.|.:.|.:|.|:.:|.|.......:|.
plant   265 PRILSLLKNMIVSRYSLVQTN-ALASLVNLSLDKKNKLTIVRLGFVPILIDVLKSGSREAQEHAA 328

  Fly   265 TTLHNLLLHQDGSKMAVRLAGGLQKMVTLL------QRNNVKFLAIVTDCLQILAYGNQESKLII 323
            .|:.:|.| :|.:||.:.:.|.||.::..|      :..:...||:....|      ||.::..:
plant   329 GTIFSLSL-EDDNKMPIGVLGALQPLLHALRAAESDRTRHDSALALYHLTL------NQTNRSKL 386

  Fly   324 LASGGPNELVRIMRSYDYEKLLWTTSRVLKV---LSVCSSNKPAIVDAGGMQALAMHLGNM---- 381
            :..|....|..::||.:      :.||.|.|   |:.||..:.|::||   .|:|:.:|.:    
plant   387 VRLGAVPALFSMVRSGE------SASRALLVICNLACCSEGRSAMLDA---NAVAILVGKLREEW 442

  Fly   382 ---------SPRLVQNCLWTLRNLSDAATKVEGL 406
                     |....:||:..|..||..:.:.:||
plant   443 TEEPTEARSSSSARENCVAALFALSHESLRFKGL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 39/180 (22%)
armadillo repeat 161..186 CDD:293788 6/35 (17%)
armadillo repeat 193..231 CDD:293788 10/37 (27%)
armadillo repeat 238..270 CDD:293788 8/31 (26%)
armadillo repeat 278..314 CDD:293788 9/41 (22%)
armadillo repeat 320..355 CDD:293788 8/37 (22%)
Arm 361..398 CDD:278915 11/49 (22%)
armadillo repeat 362..397 CDD:293788 10/47 (21%)
armadillo repeat 410..435 CDD:293788
Arm 439..481 CDD:278915
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:278915
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
PUB38NP_201323.1 Ubox 36..101 CDD:128780
armadillo repeat 265..293 CDD:293788 7/28 (25%)
PLN03200 285..>495 CDD:215629 53/209 (25%)
armadillo repeat 300..336 CDD:293788 10/35 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.