DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and AT5G62560

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_201062.1 Gene:AT5G62560 / 836376 AraportID:AT5G62560 Length:559 Species:Arabidopsis thaliana


Alignment Length:471 Identity:90/471 - (19%)
Similarity:177/471 - (37%) Gaps:93/471 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HNNQYNPPDL----------PPMVSAKEQTL------MWQQNSYLGD--SGIHSGAVTQVPSLSG 59
            |.:...||:.          .|:|.:..||.      :.:...|:.|  .|......|.:|:|:.
plant    26 HKHDETPPEFLCPITGFLMSDPVVVSSGQTFERLSVQVCRNLGYIPDLLDGTRPDLSTVIPNLAM 90

  Fly    60 KE------DEEMEGDPLMFDLDTGFPQNFTQDQVD-DMNQQLSQTRS------------------ 99
            |.      |.:....|.  ..|..:.:...:.::| |.|....|:..                  
plant    91 KSTIFSWCDRQKVDHPR--PPDAAYVEGVVRARMDKDPNPSPGQSPGPGDKDPEPEILPPVEENS 153

  Fly   100 --------QRVRA----AMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVV------- 145
                    :.:||    :|.|.|..|.:.|..:.:.|.:  ||...|..:......|.       
plant   154 PSDYDAVMEAIRARSKNSMSPTTSLESVTIGQSSYHPVR--AVSMFSSSTTSSSSGVFAGADSPF 216

  Fly   146 -NLINYQDDAELATRAIP---ELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAAL 206
             |.:::......::...|   |:...|...|.....|..:::.::::........:.:.::::.|
plant   217 RNAMSFSSTDHSSSPMSPEEEEIFNKLRGTDIFDHEQGLILLRKMTRSSEDLRVSLCTDRILSFL 281

  Fly   207 VRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLL 271
            ...:.:..:|..|.||...: |||..:|..:.|.:||.:|.|:.:|.|.......:....|.:|.
plant   282 RSLLVSRYNLVQTNAAASVV-NLSLEKQNKVKIVRSGFVPLLIDVLKSGTTEAQEHVAGALFSLA 345

  Fly   272 LHQDGSKMAVRLAGGLQKMVTLLQRNNV----KFLAIVTDCLQILAYGNQESKLIILASGGPNEL 332
            | :|.:||.:.:.|.::.::..|:.:..    :..|:....|.::    ..::..::.:|....|
plant   346 L-EDENKMVIGVLGAVEPLLHALRSSESERARQDAALALYHLSLI----PSNRTRLVRAGAVPTL 405

  Fly   333 VRIMRSYDYEKLLWTTSRVLKV---LSVCSSNKPAIVDAGGMQALAMHL----GNMSPRLVQNCL 390
            :.::||.|      :|||:|.|   |:.|...|.|::|...:..|...|    |..|....:||:
plant   406 LSMVRSGD------STSRILLVLCNLAACPDGKGAMLDGNAVAILVGKLREVGGGDSEAARENCV 464

  Fly   391 WTLRNLSDAATKVEGL 406
            ..|..|.....:..||
plant   465 AVLLTLCQGNLRFRGL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 31/170 (18%)
armadillo repeat 161..186 CDD:293788 5/27 (19%)
armadillo repeat 193..231 CDD:293788 7/37 (19%)
armadillo repeat 238..270 CDD:293788 8/31 (26%)
armadillo repeat 278..314 CDD:293788 6/39 (15%)
armadillo repeat 320..355 CDD:293788 10/37 (27%)
Arm 361..398 CDD:278915 11/40 (28%)
armadillo repeat 362..397 CDD:293788 10/38 (26%)
armadillo repeat 410..435 CDD:293788
Arm 439..481 CDD:278915
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:278915
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
AT5G62560NP_201062.1 Ubox 34..97 CDD:128780 11/62 (18%)
armadillo repeat 278..303 CDD:293788 5/25 (20%)
PLN03200 295..>512 CDD:215629 48/198 (24%)
armadillo repeat 310..346 CDD:293788 9/35 (26%)
armadillo repeat 351..383 CDD:293788 5/31 (16%)
armadillo repeat 432..472 CDD:293788 11/39 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.