DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and PUB15

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_199049.2 Gene:PUB15 / 834240 AraportID:AT5G42340 Length:660 Species:Arabidopsis thaliana


Alignment Length:504 Identity:111/504 - (22%)
Similarity:192/504 - (38%) Gaps:116/504 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LSGKEDEEMEGDPLMFDLDTGFPQNFTQD--QVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPS 119
            :||...:|:  |.|...|.....:..|||  ...||....|:|..:...:|:. |.|.:.:|:.:
plant   164 ISGDAKDEI--DSLCKQLKKAKRRTDTQDIELAVDMMVVFSKTDPRNADSAII-ERLAKKLELQT 225

  Fly   120 TQFDPQQPTAVQRLSEPSQML----KHAVVNLIN--------------YQDDAELATRAIPELIK 166
            ......:..|:|.|.:....|    |..::.|:|              ||   .:..:||.:...
plant   226 IDDLKTETIAIQSLIQDKGGLNIETKQHIIELLNKFKKLQGLEATDILYQ---PVINKAITKSTS 287

  Fly   167 LLNDED-------QVVVSQAAMMVHQLSKKE-----------------------------ASRHA 195
            |:...:       ::::....:...|..:||                             |.::.
plant   288 LILPHEFLCPITLEIMLDPVIIATGQTYEKESIQKWFDAGHKTCPKTRQELDHLSLAPNFALKNL 352

  Fly   196 IMN--------------SPQM-------VAALVRAISNSNDLESTKAAVGTLHNLSHHR-QGLLA 238
            ||.              ||..       |:.||.|:| |:.||..:.:|..:..|:... :..:.
plant   353 IMQWCEKNNFKIPEKEVSPDSQNEQKDEVSLLVEALS-SSQLEEQRRSVKQMRLLARENPENRVL 416

  Fly   239 IFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKF-- 301
            |..:|.||.||:|||.|...:...|:|||.||.:.:...|: :...|.:..::.:|:..|.:.  
plant   417 IANAGAIPLLVQLLSYPDSGIQENAVTTLLNLSIDEVNKKL-ISNEGAIPNIIEILENGNREARE 480

  Fly   302 -LAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSR-------VLKVLSVC 358
             .|.....|.:|    .|:|:.|..|.|...||.:::.        .|.|       .|..||:.
plant   481 NSAAALFSLSML----DENKVTIGLSNGIPPLVDLLQH--------GTLRGKKDALTALFNLSLN 533

  Fly   359 SSNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGLEAL-----LQSLVQVLG 418
            |:||...:|||.:|.|...|.:.:..::...|..|..|   |:..||.:|:     :::||:.:.
plant   534 SANKGRAIDAGIVQPLLNLLKDKNLGMIDEALSILLLL---ASHPEGRQAIGQLSFIETLVEFIR 595

  Fly   419 STDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREE 467
            ........||..:|..|..||........|.|..:.||....:..:|.:
plant   596 QGTPKNKECATSVLLELGSNNSSFILAALQFGVYEYLVEITTSGTNRAQ 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 46/224 (21%)
armadillo repeat 161..186 CDD:293788 2/31 (6%)
armadillo repeat 193..231 CDD:293788 14/58 (24%)
armadillo repeat 238..270 CDD:293788 14/31 (45%)
armadillo repeat 278..314 CDD:293788 7/38 (18%)
armadillo repeat 320..355 CDD:293788 9/41 (22%)
Arm 361..398 CDD:278915 11/36 (31%)
armadillo repeat 362..397 CDD:293788 9/34 (26%)
armadillo repeat 410..435 CDD:293788 5/24 (21%)
Arm 439..481 CDD:278915 6/29 (21%)
armadillo repeat 443..481 CDD:293788 5/25 (20%)
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:278915
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
PUB15NP_199049.2 MLKL_NTD 52..>154 CDD:414374
Ubox 293..356 CDD:128780 6/62 (10%)
PLN03200 <406..>541 CDD:215629 39/147 (27%)
Arm 410..449 CDD:395413 15/38 (39%)
armadillo repeat 423..448 CDD:293788 12/24 (50%)
armadillo repeat 455..491 CDD:293788 6/36 (17%)
armadillo repeat 496..530 CDD:293788 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.