DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and AT5G37490

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_198565.1 Gene:AT5G37490 / 833727 AraportID:AT5G37490 Length:435 Species:Arabidopsis thaliana


Alignment Length:240 Identity:47/240 - (19%)
Similarity:101/240 - (42%) Gaps:47/240 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 INYQDDAELAT----RAIPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVR 208
            |..:..::||:    |.:..|:|  :.:|.|..:.|.:|...||..|...|:......:..|||:
plant   200 IGLEGISKLASATSFRCVAGLLK--STDDSVRQNAAFIMKEILSLDETRVHSFAVENGVAEALVK 262

  Fly   209 AISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPAL-VKLLSSPVESVLFYAITTLHNLLL 272
            .|.:|....|||:::..::.:...:..:.:.|...|:.:: |:::.....||...|:..| :.:.
plant   263 LIRDSVSSSSTKSSLIAIYQMVLQKPEIASEFLEIGLVSITVEMIVDAENSVCEKALAVL-DAIC 326

  Fly   273 HQDGSKMAVR--------LAGGLQKMVTLLQRNNVKFL---------AIVTDCLQILAYGNQESK 320
            ..:..:..||        |...:.|:..|..|:::..:         ..|.|.:::.|:   :..
plant   327 ETEHGREEVRKNALVMPLLVKKIAKVSELATRSSMSMILKLWKTGNTVAVEDAVRLGAF---QKV 388

  Fly   321 LIILASG-------GPNELVRIMRSYDYEKLLWTTSRVLKVLSVC 358
            |::|..|       ...||:::|.:.            :|::|.|
plant   389 LLVLQVGYGEETKEKATELLKMMNTQ------------MKLMSDC 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 36/185 (19%)
armadillo repeat 161..186 CDD:293788 6/24 (25%)
armadillo repeat 193..231 CDD:293788 9/37 (24%)
armadillo repeat 238..270 CDD:293788 7/32 (22%)
armadillo repeat 278..314 CDD:293788 8/52 (15%)
armadillo repeat 320..355 CDD:293788 7/41 (17%)
Arm 361..398 CDD:278915
armadillo repeat 362..397 CDD:293788
armadillo repeat 410..435 CDD:293788
Arm 439..481 CDD:278915
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:278915
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
AT5G37490NP_198565.1 Ubox 34..97 CDD:128780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.