DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and AT5G18340

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_197335.1 Gene:AT5G18340 / 831952 AraportID:AT5G18340 Length:456 Species:Arabidopsis thaliana


Alignment Length:351 Identity:80/351 - (22%)
Similarity:138/351 - (39%) Gaps:82/351 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 GIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVK--FLAIVT 306
            ||.:|::.:|||..||              .|.::.|..||...:|.|      ||:  |:..:.
plant   165 GIESLLQRISSPSSSV--------------ADQTEAAKELALQTEKFV------NVRDFFIKELP 209

  Fly   307 DCLQILAYGNQESKLIIL---ASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDA 368
            |.:..|.     :.|.:|   ....|.....|:.:      |:..|...|..:|.:.|...|   
plant   210 DSITRLL-----TPLSVLGDEVDSNPELQENIVTA------LFNMSTFEKNKTVLAENHQVI--- 260

  Fly   369 GGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATK--VEGLEALLQSLVQVLGSTD----VNVVTC 427
             .:.|.:|..|::..|  :|...||.:|||..:.  :.|....|::|:.::|..|    .:...|
plant   261 -PLLAKSMKQGSVVTR--RNATLTLASLS
DIDSNKIIIGNSVALKALIDLIGELDDLSATHDALC 322

  Fly   428 AAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEPAVCALRHLTSRH--VDSELAQ 490
            |   :.:|.|:.:.|......:|...|.::   |...|..:.| ::.||. |.|.|  |..|:| 
plant   323 A---VIDLCCDERENWKKAISLGLAPAAIK---NIKARRNLFE-SLAALA-LISPHERVIQEVA- 378

  Fly   491 NAVRLNYGLSV-IVKLLHPPSRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQD 554
                 |.|:.. ::.:|...|.....:..:.::.|:      :|..||        |.:.:...:
plant   379 -----NLGVIYDLLSILRKTSCMVTCENAVVIVGNM------YAKSRE--------RSIKKILAE 424

  Fly   555 TERQR---SSIATTGSQQPSAYADGV 577
            .|.|.   :.|||.||......|.|:
plant   425 EENQHKTFTKIATQGSVVAVMKAQGI 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 19/71 (27%)
armadillo repeat 161..186 CDD:293788
armadillo repeat 193..231 CDD:293788
armadillo repeat 238..270 CDD:293788 8/25 (32%)
armadillo repeat 278..314 CDD:293788 10/37 (27%)
armadillo repeat 320..355 CDD:293788 7/37 (19%)
Arm 361..398 CDD:278915 10/36 (28%)
armadillo repeat 362..397 CDD:293788 8/34 (24%)
armadillo repeat 410..435 CDD:293788 6/28 (21%)
Arm 439..481 CDD:278915 9/41 (22%)
armadillo repeat 443..481 CDD:293788 8/37 (22%)
armadillo repeat 490..525 CDD:293788 4/35 (11%)
Arm 597..636 CDD:278915
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
AT5G18340NP_197335.1 Ubox 77..139 CDD:128780
ARM 164..286 CDD:237987 36/157 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.