DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and PUB8

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_193866.1 Gene:PUB8 / 827885 AraportID:AT4G21350 Length:374 Species:Arabidopsis thaliana


Alignment Length:341 Identity:79/341 - (23%)
Similarity:154/341 - (45%) Gaps:36/341 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 EIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQVVVSQAA 180
            ::|:   |.:.|.:::.:|:|..:......:.::.|...:...|..| :.||...|...::...|
plant     4 DLPN---DFRCPISLEIMSDPVILQSGHTFDRVSIQQWIDSGNRTCP-ITKLPLSETPYLIPNHA 64

  Fly   181 M------MVHQLSKKEASR------HAIMNSPQMVAALV-RAISNSNDLES-TKAAVGTLHNLSH 231
            :      ..| :|.||:||      |:...|..:::.|| ::.||::.||| |:....|..:.|.
plant    65 LRSLILNFAH-VSLKESSRPRTQQEHSHSQSQALISTLVSQSSSNASKLESLTRLVRLTKRDSSI 128

  Fly   232 HRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQR 296
            .|:    :.:||.:.|.:..:.|..:.:...:::.|.||.| :|.:|:.:...|.::::||:|:.
plant   129 RRK----VTESGAVRAALDCVDSCNQVLQEKSLSLLLNLSL-EDDNKVGLVADGVIRRIVTVLRV 188

  Fly   297 NNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMR-SYDYEKLLWTTSRVLKVLSVCS- 359
            .:....||....|..||........|.......:.||.::| ..|.|:....|:    :.::|| 
plant   189 GSPDCKAIAATLLTSLAVVEVNKATIGSYPDAISALVSLLRVGNDRERKESATA----LYALCSF 249

  Fly   360 -SNKPAIVDAGGMQALAMHLGNMSPRLVQ--NCLWTLRNLSDAATKVEGLEALLQSLVQVLGSTD 421
             .|:..:||.|.:..|.....:...|.|:  ..|...|...:..:||.|   .::.||.||.:.:
plant   250 PDNRKRVVDCGSVPILVEAADSGLERAVEVLGLLVKCRGGREEMSKVSG---FVEVLVNVLRNGN 311

  Fly   422 VNVVTCAAGILSNLTC 437
            :..:..:..||:.|.|
plant   312 LKGIQYSLFILNCLCC 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 44/177 (25%)
armadillo repeat 161..186 CDD:293788 6/30 (20%)
armadillo repeat 193..231 CDD:293788 12/45 (27%)
armadillo repeat 238..270 CDD:293788 5/31 (16%)
armadillo repeat 278..314 CDD:293788 9/35 (26%)
armadillo repeat 320..355 CDD:293788 7/35 (20%)
Arm 361..398 CDD:278915 9/38 (24%)
armadillo repeat 362..397 CDD:293788 8/36 (22%)
armadillo repeat 410..435 CDD:293788 6/24 (25%)
Arm 439..481 CDD:278915
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:278915
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
PUB8NP_193866.1 Ubox 8..72 CDD:128780 11/64 (17%)
ARM 173..284 CDD:237987 25/114 (22%)
armadillo repeat 179..204 CDD:293788 6/24 (25%)
armadillo repeat 211..248 CDD:293788 7/40 (18%)
armadillo repeat 294..325 CDD:293788 9/33 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.