DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and PUB22

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_190813.1 Gene:PUB22 / 824410 AraportID:AT3G52450 Length:435 Species:Arabidopsis thaliana


Alignment Length:417 Identity:78/417 - (18%)
Similarity:154/417 - (36%) Gaps:98/417 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 PTAVQRLSEPSQMLKHAVVNLINYQD----DAELATRAIP---------ELIKLLNDEDQVVVSQ 178
            |...|.::|......|.:..||  |.    :|......||         |:.||:.:.....::|
plant    50 PVTKQVITETDLTPNHTLRRLI--QSWCTLNASYGIERIPTPKPPICKSEIEKLIKESSSSHLNQ 112

  Fly   179 AAMM--VHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQG--LLAI 239
            ...:  :.|:..:..:....:.:.::...|...:|||.|..::.::..:..||:...|.  |...
plant   113 VKCLKRLRQIVSENTTNKRCLEAAEVPEFLANIVSNSVDTYNSPSSSLSSSNLNDMCQSNMLENR 177

  Fly   240 FKSGGIPALVKLLSSPVESVLFY---AITTLHNLLLHQDGSKMAVRLAGGLQKMV-------TLL 294
            |.|.      :.|.....|||::   :.|.|.:||.::.|:.:...|...:|:.:       .||
plant   178 FDSS------RSLMDEALSVLYHLDTSETALKSLLNNKKGTNLVKTLTKIMQRGIYESRAYAALL 236

  Fly   295 QRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCS 359
                :|.|..|.|.:||:..   |.:|.       .|:::|:......|...:..::|.:.....
plant   237 ----LKKLLEVADPMQIILL---ERELF-------GEVIQILHDQISHKATRSAMQILVITCPWG 287

  Fly   360 SNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGSTDVNV 424
            .|:...|: ||..::.:.|      |:.:...:.|..|:.|..|  |:.|.|             
plant   288 RNRHKAVE-GGTISMIIEL------LMDDTFSSERRNSEMAMVV--LDMLCQ------------- 330

  Fly   425 VTCAAG-----------------ILSNLTCNNQRNKATVCQVG---GVDALVRTIINAGDREEIT 469
              ||.|                 ||......::|....:..||   ...:|::.::..|     .
plant   331 --CAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRVLLSVGRFCATPSLLQEMLQLG-----V 388

  Fly   470 EPAVCALRHLTSRHVDSELAQNAVRLN 496
            ...:|.:..::..:...|.|:..::|:
plant   389 VAKLCLVLQVSCGNKTKEKAKELLKLH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 39/190 (21%)
armadillo repeat 161..186 CDD:293788 6/35 (17%)
armadillo repeat 193..231 CDD:293788 7/37 (19%)
armadillo repeat 238..270 CDD:293788 8/34 (24%)
armadillo repeat 278..314 CDD:293788 10/42 (24%)
armadillo repeat 320..355 CDD:293788 5/34 (15%)
Arm 361..398 CDD:278915 7/36 (19%)
armadillo repeat 362..397 CDD:293788 6/34 (18%)
armadillo repeat 410..435 CDD:293788 6/41 (15%)
Arm 439..481 CDD:278915 6/44 (14%)
armadillo repeat 443..481 CDD:293788 5/40 (13%)
armadillo repeat 490..525 CDD:293788 1/7 (14%)
Arm 597..636 CDD:278915
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
PUB22NP_190813.1 Ubox 11..74 CDD:128780 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.