DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and PUB13

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_190235.1 Gene:PUB13 / 823804 AraportID:AT3G46510 Length:660 Species:Arabidopsis thaliana


Alignment Length:760 Identity:137/760 - (18%)
Similarity:235/760 - (30%) Gaps:287/760 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MVSAKEQTLMWQQNS--YLGDSGIHSGAVTQVPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQ--- 84
            |.|||:......|.|  ||         |.:...::.|          :.::.....|:.:|   
plant    72 MCSAKDYLKFCSQGSKIYL---------VMEREQVTSK----------LMEVSVKLEQSLSQIPY 117

  Fly    85 ---DQVDDMNQQ----LSQTRSQRVRAAMFPETLEEGIEI---PSTQFDPQQPTAVQRLSEPSQM 139
               |..|::.:|    |||.|..:.|..:..:.|.|.::.   .|:..|..|| .::|:::...:
plant   118 EELDISDEVREQVELVLSQFRRAKGRVDVSDDELYEDLQSLCNKSSDVDAYQP-VLERVAKKLHL 181

  Fly   140 LK-----------HAVV----------------------NLINYQDD-----------------A 154
            ::           |.:|                      :.:..:||                 :
plant   182 MEIPDLAQESVALHEMVASSGGDVGENIEEMAMVLKMIKDFVQTEDDNGEEQKVGVNSRSNGQTS 246

  Fly   155 ELATRAIPEL-------IKLLNDEDQVVVSQAAMMVHQLSKK-------------EASRHAIMNS 199
            ..|::.||.:       |.|....|.|:||..........:|             :|.....:..
plant   247 TAASQKIPVIPDDFRCPISLEMMRDPVIVSSGQTYERTCIEKWIEGGHSTCPKTQQALTSTTLTP 311

  Fly   200 PQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAI 264
            ..::.:|:.....:||:|..|.                   .|...|..|...|||.|       
plant   312 NYVLRSLIAQWCEANDIEPPKP-------------------PSSLRPRKVSSFSSPAE------- 350

  Fly   265 TTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGP 329
                               |..::.::..|...|.:........:::||..|.::::.|..:|..
plant   351 -------------------ANKIEDLMWRLAYGNPEDQRSAAGEIRLLAKRNADNRVAIAEAGAI 396

  Fly   330 NELVRIMRSYDYEKLLWTTSRV-------LKVLSVCSSNKPAIVDAGGMQALAMHL--GNMSPRL 385
            ..||.::.:.|        ||:       |..||:|.:||.|||.||.:..:...|  |:|..| 
plant   397 PLLVGLLSTPD--------SRIQEHSVTALLNLSICENNKGAIVSAGAIPGIVQVLKKGSMEAR- 452

  Fly   386 VQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVG 450
             :|...||.:||                          |:              ..||.|:..:|
plant   453 -ENAAATLFSLS--------------------------VI--------------DENKVTIGALG 476

  Fly   451 GVDALVRTIINAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVKLLHPPSRWPLI 515
            .:..|| .::|.|.:....:.|..                                         
plant   477 AIPPLV-VLLNEGTQRGKKDAATA----------------------------------------- 499

  Fly   516 KAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRME 580
                  :.||.:...|.......|.|..|.|||      ||        .||             
plant   500 ------LFNLCIYQGNKGKAIRAGVIPTLTRLL------TE--------PGS------------- 531

  Fly   581 EIVEGTVGALHILARESHNRALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIE 645
            .:|:..:..|.||:.....:|:|.....:|..|..:.......:..||.||..|.:. :...::|
plant   532 GMVDEALAILAILSSHPEGKAIIGSSDAVPSLVEFIRTGSPRNRENAAAVLVHLCSG-DPQHLVE 595

  Fly   646 QE--GATGPLTDLLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLS 688
            .:  |..|||.||..:..:.....||.:|.|:|....|..:..:|
plant   596 AQKLGLMGPLIDLAGNGTDRGKRKAAQLLERISRLAEQQKETAVS 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 29/200 (15%)
armadillo repeat 161..186 CDD:293788 8/31 (26%)
armadillo repeat 193..231 CDD:293788 5/37 (14%)
armadillo repeat 238..270 CDD:293788 7/31 (23%)
armadillo repeat 278..314 CDD:293788 4/35 (11%)
armadillo repeat 320..355 CDD:293788 8/41 (20%)
Arm 361..398 CDD:278915 15/38 (39%)
armadillo repeat 362..397 CDD:293788 13/36 (36%)
armadillo repeat 410..435 CDD:293788 1/24 (4%)
Arm 439..481 CDD:278915 9/41 (22%)
armadillo repeat 443..481 CDD:293788 8/37 (22%)
armadillo repeat 490..525 CDD:293788 0/34 (0%)
Arm 597..636 CDD:278915 9/38 (24%)
armadillo repeat 600..636 CDD:293788 9/35 (26%)
armadillo repeat 641..675 CDD:293788 10/35 (29%)
PUB13NP_190235.1 Ubox 259..322 CDD:128780 9/62 (15%)
U-box domain, a modified RING finger 262..300 CDD:319578 7/37 (19%)
PLN03200 383..>646 CDD:215629 78/384 (20%)
armadillo repeat 389..421 CDD:293788 8/39 (21%)
armadillo repeat 428..463 CDD:293788 13/36 (36%)
armadillo repeat 469..503 CDD:293788 8/81 (10%)
armadillo repeat 511..544 CDD:293788 12/59 (20%)
armadillo repeat 551..587 CDD:293788 9/35 (26%)
armadillo repeat 593..627 CDD:293788 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.