DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and PUB23

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_181137.2 Gene:PUB23 / 818166 AraportID:AT2G35930 Length:411 Species:Arabidopsis thaliana


Alignment Length:342 Identity:73/342 - (21%)
Similarity:124/342 - (36%) Gaps:87/342 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 SYD---YEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGNMSP-----RLVQNCLWTLR 394
            :||   .||.|:...:     :.|...|..|.||           :::|     ||:|:  |...
plant    36 TYDRDSIEKWLFAGKK-----NSCPVTKQDITDA-----------DLTPNHTLRRLIQS--W
CTL 82

  Fly   395 NLSDAATKVEG-----LEALLQSLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDA 454
            |.|....::..     .::.::.|::...|:..|.|.|... |..:...|..||..:...|..:.
plant    83 NASYGVERIPTPRPPICKSEIEKLIRDSASSHENQVKCLKR-LRQIVSENATNKRCLEAAGVPEF 146

  Fly   455 LVRTIINAGDREEITEPAVCALRHL-TSRHVDSELAQNAVRLNYGLSVIVKLLHPPSRWPLIKAV 518
            |...:.|..:...:|:.|:..|.|| ||..|...|..|....|     |||.|            
plant   147 LANIVSNDSENGSLTDEALNLLYHLETSETVLKNLLNNKKDNN-----IVKSL------------ 194

  Fly   519 IGLIRNLALCPANHAPLREHGAIHHLV--RLLMRAFQDTERQRSSIATTGSQQPSAYADGVR-ME 580
                          ..:.:.|.....|  .||::...:......|:    :.:|..:.:.|: ::
plant   195 --------------TKIMQRGMYESRVYATLLLKNILEVADPMQSM----TLKPEVFTEVVQILD 241

  Fly   581 EIV--EGTVGALHILAR---ESHNRALIRQQSVIPIFVRLLFNEIENIQR-------VAAGVLCE 633
            :.:  :.|..|:|||..   ...||....:..||.:.:.||.:|....:|       |...:||:
plant   242 DRISQKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTSERRGPEMAMVVLDLLCQ 306

  Fly   634 LAADKEG-AEIIEQEGA 649
            .|   || ||.:....|
plant   307 CA---EGRAEFLNHGAA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138
armadillo repeat 161..186 CDD:293788
armadillo repeat 193..231 CDD:293788
armadillo repeat 238..270 CDD:293788
armadillo repeat 278..314 CDD:293788
armadillo repeat 320..355 CDD:293788 5/19 (26%)
Arm 361..398 CDD:278915 10/41 (24%)
armadillo repeat 362..397 CDD:293788 10/39 (26%)
armadillo repeat 410..435 CDD:293788 6/24 (25%)
Arm 439..481 CDD:278915 11/42 (26%)
armadillo repeat 443..481 CDD:293788 9/38 (24%)
armadillo repeat 490..525 CDD:293788 6/34 (18%)
Arm 597..636 CDD:278915 11/45 (24%)
armadillo repeat 600..636 CDD:293788 10/42 (24%)
armadillo repeat 641..675 CDD:293788 3/9 (33%)
PUB23NP_181137.2 Ubox 16..79 CDD:128780 14/60 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.