| Sequence 1: | NP_001259149.1 | Gene: | arm / 31151 | FlyBaseID: | FBgn0000117 | Length: | 843 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001365934.1 | Gene: | Uckl1 / 68556 | MGIID: | 1915806 | Length: | 549 | Species: | Mus musculus |
| Alignment Length: | 255 | Identity: | 47/255 - (18%) |
|---|---|---|---|
| Similarity: | 93/255 - (36%) | Gaps: | 66/255 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 57 LSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQ 121
Fly 122 FDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELI--KLLNDEDQVV--------- 175
Fly 176 VSQAAM----MVHQLSK--KEASRHAIMNSPQMVAALV-RAISNS-----------NDLESTK-- 220
Fly 221 ---AAVGTLHNLSHHRQGLLAIFKS----GGIPALVKLLSSPVESVLFYAITTLHNLLLH 273 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| arm | NP_001259149.1 | Adaptin_N | <150..>314 | CDD:331138 | 30/162 (19%) |
| armadillo repeat | 161..186 | CDD:293788 | 6/39 (15%) | ||
| armadillo repeat | 193..231 | CDD:293788 | 10/54 (19%) | ||
| armadillo repeat | 238..270 | CDD:293788 | 5/35 (14%) | ||
| armadillo repeat | 278..314 | CDD:293788 | |||
| armadillo repeat | 320..355 | CDD:293788 | |||
| Arm | 361..398 | CDD:278915 | |||
| armadillo repeat | 362..397 | CDD:293788 | |||
| armadillo repeat | 410..435 | CDD:293788 | |||
| Arm | 439..481 | CDD:278915 | |||
| armadillo repeat | 443..481 | CDD:293788 | |||
| armadillo repeat | 490..525 | CDD:293788 | |||
| Arm | 597..636 | CDD:278915 | |||
| armadillo repeat | 600..636 | CDD:293788 | |||
| armadillo repeat | 641..675 | CDD:293788 | |||
| Uckl1 | NP_001365934.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..74 | ||
| UMPK | 101..299 | CDD:238981 | 32/186 (17%) | ||
| UPRTase | 330..533 | CDD:405383 | 6/36 (17%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0572 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||