DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and uckl1a

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_005167107.1 Gene:uckl1a / 570547 ZFINID:ZDB-GENE-040724-238 Length:547 Species:Danio rerio


Alignment Length:447 Identity:88/447 - (19%)
Similarity:162/447 - (36%) Gaps:111/447 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AQNRTMSHNNQYNPPDLP-----------PMVSAKEQTLMWQQNSYLGDSGIHSGA------VTQ 53
            |..:|...|......|:|           .::||:||.|. ..|.|..|   |.||      ||.
Zfish   102 ASGKTTVANKIIEALDVPWVVLLSMDSFYKVLSAEEQALA-ASNDYNFD---HPGAFDFELLVTT 162

  Fly    54 VPSLSGKEDEEMEGDPLMFDLDTGFPQNFTQD---------------------QVDDMNQQLSQT 97
            :..|...:..::.    ::|..|...|...::                     |:.||...:...
Zfish   163 LRKLKQGKSVKIP----VYDFTTHGRQKEWKNVYGASVIIFEGILSFADKELLQLMDMKIFVDTD 223

  Fly    98 RSQRVRAAMFPETLEEGIEIPST--QFDPQQPTAVQRLSEPSQMLKHAVV-----NLI------- 148
            ...|:...:..:..|.|.:|...  |::.....|.::..||:..|...||     |::       
Zfish   224 SDIRLVRRLRRDITERGRDIEGVIKQYNKFVKPAFEQYIEPTMRLSDIVVPRGGGNMVAIDLIVQ 288

  Fly   149 ---NYQDDAELATRA----------IPELIKLLNDEDQVVVSQAAMMVHQLSK-KEASR-HAIMN 198
               :..::.|::.||          :|:.:.:|....||      ..:|.:.: |:.|| ..|..
Zfish   289 HVHSQLEEREISVRALLATAHQSQPLPQTLSVLESTPQV------RGLHTIIRNKDTSRDEFIFY 347

  Fly   199 SPQMVAALV-RAISNSNDLESTKAAVGTLHNLSHH-----RQGL--LAIFKSGGI--PAL----- 248
            |.:::..|: .|:|   .|.:....:.|.....:.     .:|:  ::|.::|..  |||     
Zfish   348 SKRLMRLLIEHALS---FLPAKPCTIQTPQGQEYKGCRFGGKGITGVSILRAGETMEPALRAVCK 409

  Fly   249 -VKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQIL 312
             |::....:::.|......||.|.|.:|.|:..|           :|..:.|...|.....:::|
Zfish   410 DVRIGKILIQTNLDSGEPELHYLRLPRDISEDHV-----------ILMDSTVSTGAAAMMAVRVL 463

  Fly   313 AYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAG 369
            ...:.:.:.|:|.|....||.....:|.:.::...|:.|.|.|.......|.|.|.|
Zfish   464 LDHDVQEEQIVLVSLLMAELGVHSIAYAFPRVKIITTAVDKSLDDLLHVIPGIGDFG 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 37/191 (19%)
armadillo repeat 161..186 CDD:293788 5/24 (21%)
armadillo repeat 193..231 CDD:293788 8/39 (21%)
armadillo repeat 238..270 CDD:293788 9/39 (23%)
armadillo repeat 278..314 CDD:293788 5/35 (14%)
armadillo repeat 320..355 CDD:293788 9/34 (26%)
Arm 361..398 CDD:278915 4/9 (44%)
armadillo repeat 362..397 CDD:293788 4/8 (50%)
armadillo repeat 410..435 CDD:293788
Arm 439..481 CDD:278915
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:278915
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
uckl1aXP_005167107.1 Udk 93..300 CDD:223645 38/205 (19%)
UMPK 94..293 CDD:238981 37/198 (19%)
UPRTase 323..526 CDD:291353 46/218 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.