DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and armc3

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_688618.3 Gene:armc3 / 560136 ZFINID:ZDB-GENE-110614-1 Length:831 Species:Danio rerio


Alignment Length:545 Identity:131/545 - (24%)
Similarity:225/545 - (41%) Gaps:87/545 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EEGIEIPSTQFDP------QQPTAVQRLSEP-SQMLKHAVVNLINYQDDAE------LATRAIPE 163
            :|....|...|||      ...|||..||.| .::|..|...:..:.:..:      :...||..
Zfish     7 KEAETCPKDVFDPLSIESKTATTAVLMLSSPEEEVLAKACEAIHKFAEKGDENKTCLMCLGAIEP 71

  Fly   164 LIKLLNDEDQVVVSQAAMMVHQL-SKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLH 227
            |..|::.||::|...|.|.:..: |..|..:|  :....::.|::..:|...::...:.|...|.
Zfish    72 LSLLISHEDKIVRRNAVMALGVMASNNEVKKH--LKCLDVIPAIISKLSPEENVMVHEFATLCLA 134

  Fly   228 NLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQD-GSKMAVRLAGGLQKMV 291
            :||......:.||:|.|:..|::|||||...|...::..:.||:  || .::.||:...||..::
Zfish   135 SLSVDFSYKIQIFESNGLEPLIQLLSSPDPDVKKNSVECIFNLV--QDVQNRAAVQRLNGLPPLL 197

  Fly   292 TLLQR--NNVKFLA------IVTDCLQILAYGN-QESKLII----------LASGGPNELVRIMR 337
            .||:.  :.::.||      |.||....:|:.| |..:.|:          |..|....::..:.
Zfish   198 DLLRSEFSVIQQLALHTIEKITTDTETCVAFRNVQGFERILEVVAMKEFSDLHEGALRVILNCLE 262

  Fly   338 SYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALA-----------MHLGNMSPRLV----- 386
            ..:..:|..|...:.::|....::..|.|.|..::|:|           :|..|:...|.     
Zfish   263 DTESMQLFQTMGGLEQLLQCVGTSTVAEVKANAVKAIAKMAQSSENRKILHERNIEKTLTDLLTQ 327

  Fly   387 ----------QNCLWTLRNLS--DAATKVEGLEALLQSLVQVLGSTDVNVVTCAAGILSNLTCNN 439
                      |......:|||  |....::|    ::.:||:|.|....:...||..||:||.:|
Zfish   328 ENESVRTAVCQAVATVSKNLSSRDTFRSLDG----IRPIVQLLNSEGSELRMAAAEALSSLTNSN 388

  Fly   440 QRNKATVCQVGGVDALVRTIINAGDREEITEPAVCALRHLTSRHVDSELAQNAVRLNYGLSVIVK 504
            ..|...:....|...|||.:     ::..|..||.|...||:.....|| :.::..:..:..:|:
Zfish   389 NLNAYAIYDAEGDRLLVRQL-----QDSCTGAAVYAAMALTNMASQEEL-RKSILAHEAMPALVE 447

  Fly   505 LLHPPSRWPLIKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLMRAFQDTERQRS-SIATTGSQ 568
            |||......||.|| ..:.:|.........||..|.:..||:||.....:..|..| :|:...: 
Zfish   448 LLHSTDNNILISAV-QAVASLTCDAEARQELRNVGGLSALVQLLKSINAEIRRNASWAISVCAN- 510

  Fly   569 QPSAYADGVRMEEIVEGTVGALHIL 593
                  |.:...|:.  .||||.||
Zfish   511 ------DEITASELC--NVGALEIL 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 44/179 (25%)
armadillo repeat 161..186 CDD:293788 8/24 (33%)
armadillo repeat 193..231 CDD:293788 6/37 (16%)
armadillo repeat 238..270 CDD:293788 11/31 (35%)
armadillo repeat 278..314 CDD:293788 11/43 (26%)
armadillo repeat 320..355 CDD:293788 5/44 (11%)
Arm 361..398 CDD:278915 12/64 (19%)
armadillo repeat 362..397 CDD:293788 10/60 (17%)
armadillo repeat 410..435 CDD:293788 8/24 (33%)
Arm 439..481 CDD:278915 11/41 (27%)
armadillo repeat 443..481 CDD:293788 9/37 (24%)
armadillo repeat 490..525 CDD:293788 8/34 (24%)
Arm 597..636 CDD:278915
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
armc3XP_688618.3 ARM 31..179 CDD:237987 37/151 (25%)
armadillo repeat 60..96 CDD:293788 9/35 (26%)
ARM 108..220 CDD:237987 30/113 (27%)
armadillo repeat 110..136 CDD:293788 4/25 (16%)
armadillo repeat 144..179 CDD:293788 13/36 (36%)
armadillo repeat 184..218 CDD:293788 8/33 (24%)
ARM 268..385 CDD:237987 25/120 (21%)
HEAT_2 276..382 CDD:290374 21/109 (19%)
HEAT repeat 276..301 CDD:293787 5/24 (21%)
HEAT repeat 317..345 CDD:293787 2/27 (7%)
HEAT repeat 355..387 CDD:293787 11/35 (31%)
ARM 394..506 CDD:237987 30/118 (25%)
armadillo repeat 433..469 CDD:293788 9/36 (25%)
armadillo repeat 474..506 CDD:293788 9/31 (29%)
ARM 475..>554 CDD:237987 18/62 (29%)
EDR1 553..817 CDD:291079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.