DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and UCKL1

DIOPT Version :10

Sequence 1:NP_476665.2 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_006723869.1 Gene:UCKL1 / 54963 HGNCID:15938 Length:558 Species:Homo sapiens


Alignment Length:47 Identity:12/47 - (25%)
Similarity:17/47 - (36%) Gaps:15/47 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   727 LYGQGPPSVHSSHGGRAFHQQGYDTLPIDSMQGLEISSPVGGGGAGG 773
            :|..|.|..::.||             ..|.:...|.  :|||.|.|
Human    79 IYTAGRPPWYNEHG-------------TQSKEAFAIG--LGGGSASG 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_476665.2 CTNNAbd_dArm 85..159 CDD:439243
Adaptin_N <150..>314 CDD:396262
armadillo repeat 161..186 CDD:293788
armadillo repeat 193..231 CDD:293788
armadillo repeat 238..270 CDD:293788
armadillo repeat 278..314 CDD:293788
armadillo repeat 320..355 CDD:293788
Arm 361..398 CDD:425727
armadillo repeat 362..397 CDD:293788
armadillo repeat 410..435 CDD:293788
Arm 439..481 CDD:425727
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:425727
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
UCKL1XP_006723869.1 UMPK 101..307 CDD:238981 6/12 (50%)
UPRTase 339..542 CDD:434124
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.