DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and jup

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_989380.1 Gene:jup / 395011 XenbaseID:XB-GENE-489397 Length:737 Species:Xenopus tropicalis


Alignment Length:740 Identity:461/740 - (62%)
Similarity:571/740 - (77%) Gaps:21/740 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DLPPMVSAKEQTLMWQQNSYLGDSGIHSGAVTQVPSLSGKE--DEEMEGDPLMFDLDTGFPQNFT 83
            ||..:|....:...||: :|..||||:||..|..|||:||.  :::....|..:.:.|   ..:|
 Frog     2 DLVDVVEVPIKVTEWQK-TYTYDSGINSGINTASPSLNGKMVIEDDSHAYPGSYTVKT---TTYT 62

  Fly    84 QDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLI 148
            |.|..||:.|::.||:|||||||:|||:|:...:.:||.:.|| |.||:|:|||||||.|:::||
 Frog    63 QQQTPDMDAQINMTRAQRVRAAMYPETVEDHSYLLTTQIEGQQ-TNVQKLAEPSQMLKSAIIHLI 126

  Fly   149 NYQDDAELATRAIPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRAISNS 213
            ||||||||||||||||.|||||||.:||::|:|:|:|||||||||.|:|.|||:|||:||.:.::
 Frog   127 NYQDDAELATRAIPELTKLLNDEDPMVVNKASMIVNQLSKKEASRKALMQSPQIVAAVVRTMQHT 191

  Fly   214 NDLESTKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSK 278
            :|:::.:.....||||||||:|||:|||||||||||::|||||||||||||||||||||:|:|:|
 Frog   192 SDMDTARCTTSILHNLSHHREGLLSIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAK 256

  Fly   279 MAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEK 343
            ||||||.||||||.||.:||.|||||.|||||:||||||||||||||:|||..||:|||:|:|||
 Frog   257 MAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQGLVQIMRNYNYEK 321

  Fly   344 LLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGLEA 408
            |||||||||||||||.|||||||:|||||||..||.:.|||||||||||||||||.|||.|||:.
 Frog   322 LLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLDN 386

  Fly   409 LLQSLVQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEPAV 473
            :|:.||..|.|.||||:|||.|.||||||||.|||..|.|..||::|:.||:.|.|:::|.||||
 Frog   387 VLKILVNQLSSDDVNVLTCATGTLSNLTCNNGRNKTLVTQSNGVESLIHTILRASDKDDIAEPAV 451

  Fly   474 CALRHLTSRHVDSELAQNAVRLNYGLSVIVKLLHPPSRWPLIKAVIGLIRNLALCPANHAPLREH 538
            ||||||||||.|:|:|||:|||:||:..|||||:||.:|||:||.|||||||||||||||||.:.
 Frog   452 CALRHLTSRHQDAEVAQNSVRLHYGIPAIVKLLNPPYQWPLVKATIGLIRNLALCPANHAPLYDA 516

  Fly   539 GAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALI 603
            |.|..||:||::|.||.:|.    |.:|:|||  |.|||:|||||||..||||||||:..||..|
 Frog   517 GVIPRLVQLLVKAHQDAQRH----AASGAQQP--YTDGVKMEEIVEGCTGALHILARDPVNRMDI 575

  Fly   604 RQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSRNEGVATYA 668
            .:.:.||:||:||::.:|||||||||||||||.|||.|:.|:.|||:.||.:||||||||:||||
 Frog   576 YKLNTIPLFVQLLYSPVENIQRVAAGVLCELAQDKEAADTIDAEGASAPLMELLHSRNEGIATYA 640

  Fly   669 AAVLFRMSEDKPQDYKKRLSIELTNSLLREDNNIWANADLGMGPDLQDMLGPE-EAYEGLYGQGP 732
            ||||||:||||..||:||:|:||||::.|:|...|..|. .|.| |.|....| |.|..:|.:..
 Frog   641 AAVLFRISEDKNADYRKRVSVELTNAIFRQDPAAWEAAQ-SMIP-LNDPYPDEMENYRAMYPEDI 703

  Fly   733 PSVHSSHGGR---AFHQQGYDTLPI 754
            |.  ...||.   .:...||...|:
 Frog   704 PL--EPMGGDMDVEYAMDGYSDHPV 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 120/163 (74%)
armadillo repeat 161..186 CDD:293788 16/24 (67%)
armadillo repeat 193..231 CDD:293788 16/37 (43%)
armadillo repeat 238..270 CDD:293788 28/31 (90%)
armadillo repeat 278..314 CDD:293788 28/35 (80%)
armadillo repeat 320..355 CDD:293788 28/34 (82%)
Arm 361..398 CDD:278915 30/36 (83%)
armadillo repeat 362..397 CDD:293788 28/34 (82%)
armadillo repeat 410..435 CDD:293788 15/24 (63%)
Arm 439..481 CDD:278915 24/41 (59%)
armadillo repeat 443..481 CDD:293788 21/37 (57%)
armadillo repeat 490..525 CDD:293788 24/34 (71%)
Arm 597..636 CDD:278915 23/38 (61%)
armadillo repeat 600..636 CDD:293788 22/35 (63%)
armadillo repeat 641..675 CDD:293788 24/33 (73%)
jupNP_989380.1 armadillo repeat 139..164 CDD:293788 16/24 (67%)
armadillo repeat 172..209 CDD:293788 15/36 (42%)
armadillo repeat 217..248 CDD:293788 28/30 (93%)
ARM 217..248 CDD:214547 28/30 (93%)
armadillo repeat 256..292 CDD:293788 28/35 (80%)
armadillo repeat 300..333 CDD:293788 26/32 (81%)
ARM 336..376 CDD:214547 32/39 (82%)
armadillo repeat 340..375 CDD:293788 28/34 (82%)
PLN03200 <384..>682 CDD:215629 191/304 (63%)
armadillo repeat 388..413 CDD:293788 15/24 (63%)
armadillo repeat 421..459 CDD:293788 21/37 (57%)
armadillo repeat 468..503 CDD:293788 24/34 (71%)
armadillo repeat 519..565 CDD:293788 29/51 (57%)
armadillo repeat 572..608 CDD:293788 22/35 (63%)
armadillo repeat 613..647 CDD:293788 24/33 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 158 1.000 Domainoid score I4062
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D163964at33208
OrthoFinder 1 1.000 - - FOG0002078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1754
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.