DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and CG11593

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_001261392.1 Gene:CG11593 / 38477 FlyBaseID:FBgn0035488 Length:484 Species:Drosophila melanogaster


Alignment Length:329 Identity:66/329 - (20%)
Similarity:108/329 - (32%) Gaps:110/329 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NPPDLPPMVSAKEQTLMWQQNSYLGDSGIHSGAVTQVPSLSGKEDEE---MEGDPLMFDLDTGFP 79
            |.||:   :|::...   ..:.||.....:..:|:.:|:.:||:.:.   :.|...:..||:...
  Fly   161 NSPDI---LSSESDA---DVSQYLAAVESNFQSVSLMPNGNGKKSKRSTALPGGEDISSLDSISN 219

  Fly    80 QNFTQDQVDDMNQQLSQTRSQRVRAAMFP-ETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHA 143
            .:|..|  :|:...|         |::.| .:|.:|::......|.:.|..              
  Fly   220 HSFDDD--EDIEHNL---------ASLSPSSSLIDGLDGEDDDDDCEGPEL-------------- 259

  Fly   144 VVNLINYQDDAE------LATRAIPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQM 202
               |.::.||.|      |||...|                         ...||..|....||.
  Fly   260 ---LPDHDDDLELDLEFGLATTPTP-------------------------NAPASATAASTLPQY 296

  Fly   203 VAALVRAISNSNDLESTKAAVGTLHN------------LSHHRQGLLAIFKSGGIPALVKL---- 251
            .||..|  .:|.:.:......|....            |||  .|.|   ||||..|:|..    
  Fly   297 TAAEER--RDSRNWQKITLPDGRTREIDMRVIEPYKRVLSH--GGYL---KSGGQNAIVIFCACH 354

  Fly   252 --------LSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDC 308
                    .|..::::..|.:.||..|:   ....:.:.|.||       ..|.||.....:..|
  Fly   355 LPDRSRADYSYVMDNLFLYVVKTLEQLV---TDDYVLIYLHGG-------SNRRNVPPFPWLKRC 409

  Fly   309 LQIL 312
            .|:|
  Fly   410 YQLL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 42/193 (22%)
armadillo repeat 161..186 CDD:293788 1/24 (4%)
armadillo repeat 193..231 CDD:293788 9/49 (18%)
armadillo repeat 238..270 CDD:293788 10/43 (23%)
armadillo repeat 278..314 CDD:293788 9/35 (26%)
armadillo repeat 320..355 CDD:293788
Arm 361..398 CDD:278915
armadillo repeat 362..397 CDD:293788
armadillo repeat 410..435 CDD:293788
Arm 439..481 CDD:278915
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:278915
armadillo repeat 600..636 CDD:293788
armadillo repeat 641..675 CDD:293788
CG11593NP_001261392.1 BNIP2 <293..342 CDD:289278 13/55 (24%)
CRAL_TRIO_2 345..475 CDD:290435 16/79 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.